BLASTX nr result
ID: Rehmannia27_contig00034255
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia27_contig00034255 (414 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011095094.1| PREDICTED: pentatricopeptide repeat-containi... 166 2e-46 ref|XP_012831789.1| PREDICTED: pentatricopeptide repeat-containi... 140 5e-37 ref|XP_015170040.1| PREDICTED: pentatricopeptide repeat-containi... 81 3e-15 ref|XP_015087296.1| PREDICTED: pentatricopeptide repeat-containi... 78 3e-14 ref|XP_004246310.1| PREDICTED: pentatricopeptide repeat-containi... 77 4e-14 ref|XP_002309173.2| pentatricopeptide repeat-containing family p... 76 1e-13 ref|XP_011019040.1| PREDICTED: pentatricopeptide repeat-containi... 76 1e-13 ref|XP_007026524.1| Pentatricopeptide repeat superfamily protein... 75 2e-13 ref|XP_009797175.1| PREDICTED: pentatricopeptide repeat-containi... 74 5e-13 ref|XP_008363930.1| PREDICTED: pentatricopeptide repeat-containi... 74 7e-13 ref|XP_010091108.1| hypothetical protein L484_021993 [Morus nota... 73 1e-12 ref|XP_009373117.1| PREDICTED: LOW QUALITY PROTEIN: pentatricope... 72 3e-12 gb|KVH90370.1| Pentatricopeptide repeat-containing protein [Cyna... 70 1e-11 gb|KDO63309.1| hypothetical protein CISIN_1g039177mg [Citrus sin... 70 2e-11 ref|XP_006429524.1| hypothetical protein CICLE_v10013613mg [Citr... 70 2e-11 ref|XP_010683568.1| PREDICTED: pentatricopeptide repeat-containi... 67 2e-10 ref|XP_011466430.1| PREDICTED: pentatricopeptide repeat-containi... 67 3e-10 ref|XP_010040006.1| PREDICTED: pentatricopeptide repeat-containi... 66 5e-10 ref|XP_012089729.1| PREDICTED: pentatricopeptide repeat-containi... 65 6e-10 ref|XP_008244810.1| PREDICTED: pentatricopeptide repeat-containi... 65 1e-09 >ref|XP_011095094.1| PREDICTED: pentatricopeptide repeat-containing protein At2g38420, mitochondrial [Sesamum indicum] Length = 543 Score = 166 bits (420), Expect = 2e-46 Identities = 87/129 (67%), Positives = 100/129 (77%), Gaps = 2/129 (1%) Frame = -2 Query: 389 LAYCKRVIAAEKAHPWRQQQNIYANHPINYFFCNSTALFXXXXXXXXS--LHNYYIRKRR 216 LA C VI E+A ++QQ IYAN P + FCNSTA F S LHNYYIRKRR Sbjct: 5 LADCNLVIPTERA--CQRQQQIYANCPTSNLFCNSTASFSSSSSSRKSSSLHNYYIRKRR 62 Query: 215 KWPIRPYKTQWDQIFAFRLAKQSFKQSIRKTKTHLLSDLVNSFSAYEVNPTPQSYHLLFK 36 KWPIRPYKT+ Q FAF+LAKQSFK+SIRK+KTHLLSDLV+SF+AYEV+PTP+SYH LFK Sbjct: 63 KWPIRPYKTERHQAFAFQLAKQSFKRSIRKSKTHLLSDLVSSFAAYEVDPTPESYHFLFK 122 Query: 35 ILIQKRPSN 9 +LIQ RPSN Sbjct: 123 VLIQNRPSN 131 >ref|XP_012831789.1| PREDICTED: pentatricopeptide repeat-containing protein At2g38420, mitochondrial [Erythranthe guttata] Length = 481 Score = 140 bits (353), Expect = 5e-37 Identities = 76/132 (57%), Positives = 90/132 (68%) Frame = -2 Query: 404 MSRGILAYCKRVIAAEKAHPWRQQQNIYANHPINYFFCNSTALFXXXXXXXXSLHNYYIR 225 M RG++A+CKR I H WRQQ N NY ST+ SLHNYYIR Sbjct: 1 MLRGVVAHCKRFIT----HQWRQQINP------NYSLFISTSTASFSSRKSSSLHNYYIR 50 Query: 224 KRRKWPIRPYKTQWDQIFAFRLAKQSFKQSIRKTKTHLLSDLVNSFSAYEVNPTPQSYHL 45 KRRKWPI+P+ T + FA +LAKQ FKQSIRK+K +LLSDL+ S AYE+ PTPQSYHL Sbjct: 51 KRRKWPIQPFTTHRCESFAVKLAKQLFKQSIRKSKINLLSDLIKSCVAYEIEPTPQSYHL 110 Query: 44 LFKILIQKRPSN 9 LFKILIQ++PSN Sbjct: 111 LFKILIQQKPSN 122 >ref|XP_015170040.1| PREDICTED: pentatricopeptide repeat-containing protein At2g38420, mitochondrial [Solanum tuberosum] Length = 512 Score = 80.9 bits (198), Expect = 3e-15 Identities = 39/81 (48%), Positives = 56/81 (69%), Gaps = 3/81 (3%) Frame = -2 Query: 245 LHNYYIRKRRKWPIRPYKTQW-DQIFAFRLAKQSFKQSI--RKTKTHLLSDLVNSFSAYE 75 + NY++RKRRKWP+ PYKT+W ++ +LA Q +S R KTHLLS L++SFSAYE Sbjct: 27 MDNYFLRKRRKWPLSPYKTKWQEETLTHQLAMQKLVESTSNRSPKTHLLSILIDSFSAYE 86 Query: 74 VNPTPQSYHLLFKILIQKRPS 12 +P+P +Y+ + K + K PS Sbjct: 87 CDPSPNAYYFILK-TVTKNPS 106 >ref|XP_015087296.1| PREDICTED: pentatricopeptide repeat-containing protein At2g38420, mitochondrial [Solanum pennellii] Length = 463 Score = 77.8 bits (190), Expect = 3e-14 Identities = 38/77 (49%), Positives = 53/77 (68%), Gaps = 3/77 (3%) Frame = -2 Query: 245 LHNYYIRKRRKWPIRPYKTQW-DQIFAFRLAKQSFKQSIRK--TKTHLLSDLVNSFSAYE 75 ++NY++RKRRKWP+ YKT+W ++ +L+ Q +S KTHLLS LV+SFSAYE Sbjct: 27 MNNYFLRKRRKWPLSLYKTKWQEEKLTHQLSMQKLVESTPNGSPKTHLLSILVDSFSAYE 86 Query: 74 VNPTPQSYHLLFKILIQ 24 NPTP +Y+ + K L Q Sbjct: 87 CNPTPNAYYFILKTLTQ 103 >ref|XP_004246310.1| PREDICTED: pentatricopeptide repeat-containing protein At2g38420, mitochondrial [Solanum lycopersicum] Length = 496 Score = 77.4 bits (189), Expect = 4e-14 Identities = 37/77 (48%), Positives = 54/77 (70%), Gaps = 3/77 (3%) Frame = -2 Query: 245 LHNYYIRKRRKWPIRPYKTQW-DQIFAFRLAKQSFKQSI--RKTKTHLLSDLVNSFSAYE 75 ++NY++RKRRKWP+ YKT+W ++ +L+ Q +S R KTHLLS L++SFSAYE Sbjct: 27 MNNYFLRKRRKWPLSLYKTKWQEEKLTHQLSMQKLVESTPNRSPKTHLLSILLDSFSAYE 86 Query: 74 VNPTPQSYHLLFKILIQ 24 +PTP +Y+ + K L Q Sbjct: 87 CDPTPNAYYFILKTLTQ 103 >ref|XP_002309173.2| pentatricopeptide repeat-containing family protein [Populus trichocarpa] gi|550335936|gb|EEE92696.2| pentatricopeptide repeat-containing family protein [Populus trichocarpa] Length = 490 Score = 76.3 bits (186), Expect = 1e-13 Identities = 35/79 (44%), Positives = 51/79 (64%), Gaps = 7/79 (8%) Frame = -2 Query: 239 NYYIRKRRKWPIRPYKTQWDQIFAFRLAKQSFKQSIRK-------TKTHLLSDLVNSFSA 81 ++++RK RKWP PYK +W +IF + A QS KQS K K HLLS L++SFS Sbjct: 11 SFFLRKHRKWPYSPYKARWHRIFNQQQAMQSLKQSALKPPQQESPNKPHLLSSLIHSFSI 70 Query: 80 YEVNPTPQSYHLLFKILIQ 24 Y+V P P+++ +FK L++ Sbjct: 71 YDVEPAPKAFDFIFKTLVK 89 >ref|XP_011019040.1| PREDICTED: pentatricopeptide repeat-containing protein At2g38420, mitochondrial [Populus euphratica] gi|743811542|ref|XP_011019042.1| PREDICTED: pentatricopeptide repeat-containing protein At2g38420, mitochondrial [Populus euphratica] Length = 506 Score = 76.3 bits (186), Expect = 1e-13 Identities = 35/79 (44%), Positives = 51/79 (64%), Gaps = 7/79 (8%) Frame = -2 Query: 239 NYYIRKRRKWPIRPYKTQWDQIFAFRLAKQSFKQSIRKT-------KTHLLSDLVNSFSA 81 ++++RK RKWP PYK +W +IF + A QS KQS K K HLLS L++SF Sbjct: 11 SFFLRKHRKWPYSPYKARWHRIFNQQQAMQSLKQSALKPPQQESPHKPHLLSSLIHSFGI 70 Query: 80 YEVNPTPQSYHLLFKILIQ 24 Y+V PTP+++ +FK L++ Sbjct: 71 YDVEPTPKAFDFIFKTLVK 89 >ref|XP_007026524.1| Pentatricopeptide repeat superfamily protein, putative [Theobroma cacao] gi|508715129|gb|EOY07026.1| Pentatricopeptide repeat superfamily protein, putative [Theobroma cacao] Length = 542 Score = 75.5 bits (184), Expect = 2e-13 Identities = 38/77 (49%), Positives = 49/77 (63%), Gaps = 5/77 (6%) Frame = -2 Query: 239 NYYIRKRRKWPIRPYKTQWDQIFAFRLAKQSFKQSIRKTKTHL-----LSDLVNSFSAYE 75 N ++RK R+WP YKT+W+Q F + A SFKQ + + +L LS LV SFS Y Sbjct: 54 NLFLRKHRRWPHFAYKTKWNQTFTQKQAMLSFKQLVAVAQDNLPPPILLSTLVRSFSLYN 113 Query: 74 VNPTPQSYHLLFKILIQ 24 V+PTPQ+YH L K LIQ Sbjct: 114 VHPTPQAYHFLIKTLIQ 130 >ref|XP_009797175.1| PREDICTED: pentatricopeptide repeat-containing protein At2g38420, mitochondrial [Nicotiana sylvestris] Length = 508 Score = 74.3 bits (181), Expect = 5e-13 Identities = 39/80 (48%), Positives = 54/80 (67%), Gaps = 3/80 (3%) Frame = -2 Query: 242 HNYYIRKRRKWPIRPYKTQWDQ-IFAFRLAKQSFKQSIRKT--KTHLLSDLVNSFSAYEV 72 +NYY+RK+RK P PYKT+W + F +LA Q +S K+ KT+LLS L++SF+AY+ Sbjct: 35 NNYYLRKKRKCPFSPYKTKWQETFFTHQLAVQKLVESTHKSPKKTNLLSVLIDSFAAYKC 94 Query: 71 NPTPQSYHLLFKILIQKRPS 12 PTP +Y L+ K L K PS Sbjct: 95 EPTPNAYFLILKTL-TKNPS 113 >ref|XP_008363930.1| PREDICTED: pentatricopeptide repeat-containing protein At2g38420, mitochondrial-like [Malus domestica] Length = 491 Score = 73.9 bits (180), Expect = 7e-13 Identities = 33/69 (47%), Positives = 45/69 (65%) Frame = -2 Query: 236 YYIRKRRKWPIRPYKTQWDQIFAFRLAKQSFKQSIRKTKTHLLSDLVNSFSAYEVNPTPQ 57 +++RK RKWP+ PY T+W QIF A QS K+S+ HLL L+ SF Y V+PTP+ Sbjct: 13 FFLRKHRKWPVSPYNTRWQQIFNQNQAFQSLKKSL-PPPCHLLPTLIYSFKTYNVDPTPE 71 Query: 56 SYHLLFKIL 30 +YH + K L Sbjct: 72 AYHFVLKTL 80 >ref|XP_010091108.1| hypothetical protein L484_021993 [Morus notabilis] gi|587852268|gb|EXB42398.1| hypothetical protein L484_021993 [Morus notabilis] Length = 494 Score = 73.2 bits (178), Expect = 1e-12 Identities = 33/74 (44%), Positives = 50/74 (67%) Frame = -2 Query: 245 LHNYYIRKRRKWPIRPYKTQWDQIFAFRLAKQSFKQSIRKTKTHLLSDLVNSFSAYEVNP 66 L N ++RK R++PI PYKT+W + F A Q+ K+ + LLS L+NSF++Y+ NP Sbjct: 8 LTNKFLRKHREFPISPYKTKWHETFNQTQALQTLKRHQNENPNRLLSLLLNSFNSYDCNP 67 Query: 65 TPQSYHLLFKILIQ 24 TP++YH + K LI+ Sbjct: 68 TPEAYHFVLKTLIK 81 >ref|XP_009373117.1| PREDICTED: LOW QUALITY PROTEIN: pentatricopeptide repeat-containing protein At2g38420, mitochondrial [Pyrus x bretschneideri] Length = 491 Score = 72.0 bits (175), Expect = 3e-12 Identities = 32/69 (46%), Positives = 43/69 (62%) Frame = -2 Query: 236 YYIRKRRKWPIRPYKTQWDQIFAFRLAKQSFKQSIRKTKTHLLSDLVNSFSAYEVNPTPQ 57 +++RK RKWP+ PY T+W QIF A QS K+S+ HLL L+ SF Y +PTP+ Sbjct: 13 FFLRKHRKWPVSPYNTRWQQIFNQSQAFQSLKKSL-PAPCHLLPTLIYSFKTYNADPTPE 71 Query: 56 SYHLLFKIL 30 +YH K L Sbjct: 72 AYHFFLKTL 80 >gb|KVH90370.1| Pentatricopeptide repeat-containing protein [Cynara cardunculus var. scolymus] Length = 510 Score = 70.5 bits (171), Expect = 1e-11 Identities = 34/79 (43%), Positives = 50/79 (63%), Gaps = 1/79 (1%) Frame = -2 Query: 242 HNYYIRKRRKWPIRPYKTQWDQIFAFRLAKQSFK-QSIRKTKTHLLSDLVNSFSAYEVNP 66 HNYY+RKRRKWP YK++W + + + A Q+ + Q+ + +LLS LVNSF+ Y +P Sbjct: 31 HNYYLRKRRKWPHPVYKSRWHEKLSQQHAMQALRHQASSSSSINLLSSLVNSFALYNCDP 90 Query: 65 TPQSYHLLFKILIQKRPSN 9 TP +Y K LI+ S+ Sbjct: 91 TPTAYRFAIKTLIKTSQSH 109 >gb|KDO63309.1| hypothetical protein CISIN_1g039177mg [Citrus sinensis] Length = 453 Score = 70.1 bits (170), Expect = 2e-11 Identities = 33/82 (40%), Positives = 47/82 (57%), Gaps = 10/82 (12%) Frame = -2 Query: 239 NYYIRKRRKWPIRPYKTQWDQIFAFRLAKQSFKQSIRKTKT----------HLLSDLVNS 90 N ++RK RKWP+ PYK +W Q + AKQ+ KQS+ T H+LS L++S Sbjct: 11 NLHLRKHRKWPLSPYKAKWHQTLDQQQAKQNVKQSLTTPPTKQQQQIPKQPHILSSLLHS 70 Query: 89 FSAYEVNPTPQSYHLLFKILIQ 24 FS Y P P++YH + K L + Sbjct: 71 FSIYNCEPPPEAYHFVIKTLAE 92 >ref|XP_006429524.1| hypothetical protein CICLE_v10013613mg [Citrus clementina] gi|985452616|ref|XP_015386666.1| PREDICTED: pentatricopeptide repeat-containing protein At2g38420, mitochondrial [Citrus sinensis] gi|557531581|gb|ESR42764.1| hypothetical protein CICLE_v10013613mg [Citrus clementina] Length = 506 Score = 70.1 bits (170), Expect = 2e-11 Identities = 33/82 (40%), Positives = 47/82 (57%), Gaps = 10/82 (12%) Frame = -2 Query: 239 NYYIRKRRKWPIRPYKTQWDQIFAFRLAKQSFKQSIRKTKT----------HLLSDLVNS 90 N ++RK RKWP+ PYK +W Q + AKQ+ KQS+ T H+LS L++S Sbjct: 11 NLHLRKHRKWPLSPYKAKWHQTLDQQQAKQNVKQSLTTPPTKQQQQIPKQPHILSSLLHS 70 Query: 89 FSAYEVNPTPQSYHLLFKILIQ 24 FS Y P P++YH + K L + Sbjct: 71 FSIYNCEPPPEAYHFVIKTLAE 92 >ref|XP_010683568.1| PREDICTED: pentatricopeptide repeat-containing protein At2g38420, mitochondrial isoform X1 [Beta vulgaris subsp. vulgaris] gi|870854858|gb|KMT06606.1| hypothetical protein BVRB_7g157740 [Beta vulgaris subsp. vulgaris] Length = 509 Score = 67.0 bits (162), Expect = 2e-10 Identities = 35/89 (39%), Positives = 52/89 (58%), Gaps = 16/89 (17%) Frame = -2 Query: 239 NYYIRKRRKWPIRPYKTQWDQIFAFRLAKQSFKQSIR----------------KTKTHLL 108 N ++R+RRKW PYKT+W IF + A Q+ K+S KT +HLL Sbjct: 13 NLFLRRRRKWAHSPYKTRWHYIFTQQQALQTLKKSCLSSNQDSIIQQSTQNPPKTPSHLL 72 Query: 107 SDLVNSFSAYEVNPTPQSYHLLFKILIQK 21 + L+NSF++Y+ +PT +Y+ + K LIQK Sbjct: 73 NCLINSFASYQCDPTLCAYNFVIKTLIQK 101 >ref|XP_011466430.1| PREDICTED: pentatricopeptide repeat-containing protein At2g38420, mitochondrial [Fragaria vesca subsp. vesca] Length = 491 Score = 66.6 bits (161), Expect = 3e-10 Identities = 27/71 (38%), Positives = 45/71 (63%) Frame = -2 Query: 236 YYIRKRRKWPIRPYKTQWDQIFAFRLAKQSFKQSIRKTKTHLLSDLVNSFSAYEVNPTPQ 57 +++RK RKWP+ PY T+W ++F A Q+ K S LLS L++SF+ + +PTP+ Sbjct: 13 FFVRKHRKWPVSPYNTKWHKLFNQHQALQTLKHSPLNPPQTLLSTLIHSFNTFNCDPTPE 72 Query: 56 SYHLLFKILIQ 24 +Y+ + K L + Sbjct: 73 AYNFVLKTLFK 83 >ref|XP_010040006.1| PREDICTED: pentatricopeptide repeat-containing protein At2g38420, mitochondrial [Eucalyptus grandis] gi|629123834|gb|KCW88259.1| hypothetical protein EUGRSUZ_A00644 [Eucalyptus grandis] gi|629123835|gb|KCW88260.1| hypothetical protein EUGRSUZ_A00644 [Eucalyptus grandis] Length = 507 Score = 65.9 bits (159), Expect = 5e-10 Identities = 30/89 (33%), Positives = 51/89 (57%), Gaps = 17/89 (19%) Frame = -2 Query: 239 NYYIRKRRKWPIRPYKTQWDQIFAFRLAKQSFKQSIR-----------------KTKTHL 111 N ++R+ R+WP+ PYKT+W Q F+ A ++ + ++R T+ +L Sbjct: 11 NQFLRRNRRWPLSPYKTKWHQTFSEEQAMRTLRDAVRTTVEPLCHRSNKHLPQNPTEPNL 70 Query: 110 LSDLVNSFSAYEVNPTPQSYHLLFKILIQ 24 +S LV+SFSAY PTP++YH + + L + Sbjct: 71 VSTLVDSFSAYNCEPTPKAYHFVIQSLCE 99 >ref|XP_012089729.1| PREDICTED: pentatricopeptide repeat-containing protein At2g38420, mitochondrial [Jatropha curcas] gi|802761267|ref|XP_012089731.1| PREDICTED: pentatricopeptide repeat-containing protein At2g38420, mitochondrial [Jatropha curcas] gi|802761270|ref|XP_012089732.1| PREDICTED: pentatricopeptide repeat-containing protein At2g38420, mitochondrial [Jatropha curcas] gi|802761273|ref|XP_012089733.1| PREDICTED: pentatricopeptide repeat-containing protein At2g38420, mitochondrial [Jatropha curcas] gi|802761276|ref|XP_012089734.1| PREDICTED: pentatricopeptide repeat-containing protein At2g38420, mitochondrial [Jatropha curcas] gi|643706993|gb|KDP22803.1| hypothetical protein JCGZ_00390 [Jatropha curcas] Length = 500 Score = 65.5 bits (158), Expect = 6e-10 Identities = 31/78 (39%), Positives = 45/78 (57%), Gaps = 8/78 (10%) Frame = -2 Query: 233 YIRKRRKWPIRPYKTQWDQIFAFRLAKQSFKQSIRKTK--------THLLSDLVNSFSAY 78 ++RK R+WP PYK +W IF + A Q+ KQ + ++LLS L++SFS Y Sbjct: 13 FLRKHRRWPHSPYKAKWHHIFNQQQAMQNLKQEATSLQNLQQNSKSSNLLSSLIHSFSVY 72 Query: 77 EVNPTPQSYHLLFKILIQ 24 PTPQ++H L K L + Sbjct: 73 NSEPTPQAFHFLIKTLTE 90 >ref|XP_008244810.1| PREDICTED: pentatricopeptide repeat-containing protein At2g38420, mitochondrial [Prunus mume] Length = 490 Score = 64.7 bits (156), Expect = 1e-09 Identities = 30/78 (38%), Positives = 46/78 (58%), Gaps = 2/78 (2%) Frame = -2 Query: 236 YYIRKRRKWPIRPYKTQWDQIFAFRLAKQSFKQSI--RKTKTHLLSDLVNSFSAYEVNPT 63 +++RK RKWP+ P+ T+W Q F A QS K+S + HLLS L+ SF++Y P Sbjct: 13 FFLRKHRKWPVSPHNTKWHQTFNQNQAFQSLKKSSPPQNQPQHLLSTLIYSFNSYNCEPN 72 Query: 62 PQSYHLLFKILIQKRPSN 9 P++Y+ + K L + N Sbjct: 73 PEAYNFVIKTLTKTSQFN 90