BLASTX nr result
ID: Rehmannia27_contig00032274
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia27_contig00032274 (380 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AAF43952.1|AC012188_29 Contains similarity to an Alfalfa nucl... 55 1e-06 >gb|AAF43952.1|AC012188_29 Contains similarity to an Alfalfa nucleic acid binding protein from Medicago sativa gb|L07291.1 and contains a PHD-finger PF|00628 domain. ESTs gb|AI995787, gb|AA721930, gb|T42258 come from this gene [Arabidopsis thaliana] Length = 273 Score = 55.1 bits (131), Expect = 1e-06 Identities = 25/43 (58%), Positives = 36/43 (83%) Frame = -3 Query: 372 ICNPIPRTMEKVFNNFKGRRAGLIKALTTGIFSI*FSLFTKKF 244 I +PIPRT+E+VF++F+GRRAGLIKAL+TG + FS+++ F Sbjct: 4 IQHPIPRTVEEVFSDFRGRRAGLIKALSTGQLDLSFSIYSVSF 46