BLASTX nr result
ID: Rehmannia27_contig00031969
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia27_contig00031969 (767 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU31685.1| hypothetical protein MIMGU_mgv1a024242mg [Erythra... 64 4e-09 ref|XP_010651368.1| PREDICTED: constitutive photomorphogenesis p... 64 4e-09 ref|XP_010651367.1| PREDICTED: constitutive photomorphogenesis p... 64 5e-09 ref|XP_010651366.1| PREDICTED: constitutive photomorphogenesis p... 64 5e-09 ref|XP_004228704.1| PREDICTED: constitutive photomorphogenesis p... 64 5e-09 ref|XP_015062053.1| PREDICTED: constitutive photomorphogenesis p... 64 5e-09 ref|XP_012844247.1| PREDICTED: constitutive photomorphogenesis p... 64 5e-09 ref|XP_011089731.1| PREDICTED: constitutive photomorphogenesis p... 64 5e-09 ref|XP_010651365.1| PREDICTED: constitutive photomorphogenesis p... 64 6e-09 ref|XP_009778466.1| PREDICTED: constitutive photomorphogenesis p... 63 1e-08 ref|XP_009631838.1| PREDICTED: constitutive photomorphogenesis p... 63 1e-08 ref|XP_007014687.1| Ubiquitin-conjugating enzyme family protein ... 63 1e-08 ref|XP_012067117.1| PREDICTED: constitutive photomorphogenesis p... 63 1e-08 ref|XP_002527080.1| PREDICTED: constitutive photomorphogenesis p... 63 1e-08 gb|EPS67366.1| hypothetical protein M569_07410, partial [Genlise... 62 2e-08 gb|KJB66086.1| hypothetical protein B456_010G126700 [Gossypium r... 61 2e-08 gb|KJB66083.1| hypothetical protein B456_010G126700 [Gossypium r... 61 2e-08 ref|XP_012451042.1| PREDICTED: constitutive photomorphogenesis p... 61 2e-08 ref|XP_002299458.2| hypothetical protein POPTR_0001s10830g [Popu... 62 2e-08 gb|KJB66085.1| hypothetical protein B456_010G126700 [Gossypium r... 61 2e-08 >gb|EYU31685.1| hypothetical protein MIMGU_mgv1a024242mg [Erythranthe guttata] Length = 175 Score = 63.9 bits (154), Expect = 4e-09 Identities = 30/39 (76%), Positives = 31/39 (79%) Frame = +1 Query: 1 GTPYEGGIFFLDITFPSDYPFKPPKVMLSLLINRIHCIV 117 GTPYEGGIFFLDITFPSDYPFKPPKV+ I HC V Sbjct: 70 GTPYEGGIFFLDITFPSDYPFKPPKVVFKTRI--YHCNV 106 >ref|XP_010651368.1| PREDICTED: constitutive photomorphogenesis protein 10 isoform X4 [Vitis vinifera] Length = 176 Score = 63.9 bits (154), Expect = 4e-09 Identities = 30/39 (76%), Positives = 31/39 (79%) Frame = +1 Query: 1 GTPYEGGIFFLDITFPSDYPFKPPKVMLSLLINRIHCIV 117 GTPYEGGIFFLDITFPSDYPFKPPKV+ I HC V Sbjct: 71 GTPYEGGIFFLDITFPSDYPFKPPKVVFKTRI--YHCNV 107 >ref|XP_010651367.1| PREDICTED: constitutive photomorphogenesis protein 10 isoform X3 [Vitis vinifera] Length = 177 Score = 63.9 bits (154), Expect = 5e-09 Identities = 30/39 (76%), Positives = 31/39 (79%) Frame = +1 Query: 1 GTPYEGGIFFLDITFPSDYPFKPPKVMLSLLINRIHCIV 117 GTPYEGGIFFLDITFPSDYPFKPPKV+ I HC V Sbjct: 71 GTPYEGGIFFLDITFPSDYPFKPPKVVFKTRI--YHCNV 107 >ref|XP_010651366.1| PREDICTED: constitutive photomorphogenesis protein 10 isoform X2 [Vitis vinifera] Length = 179 Score = 63.9 bits (154), Expect = 5e-09 Identities = 30/39 (76%), Positives = 31/39 (79%) Frame = +1 Query: 1 GTPYEGGIFFLDITFPSDYPFKPPKVMLSLLINRIHCIV 117 GTPYEGGIFFLDITFPSDYPFKPPKV+ I HC V Sbjct: 56 GTPYEGGIFFLDITFPSDYPFKPPKVVFKTRI--YHCNV 92 >ref|XP_004228704.1| PREDICTED: constitutive photomorphogenesis protein 10 [Solanum lycopersicum] Length = 181 Score = 63.9 bits (154), Expect = 5e-09 Identities = 30/39 (76%), Positives = 31/39 (79%) Frame = +1 Query: 1 GTPYEGGIFFLDITFPSDYPFKPPKVMLSLLINRIHCIV 117 GTPYEGGIFFLDITFPSDYPFKPPKV+ I HC V Sbjct: 76 GTPYEGGIFFLDITFPSDYPFKPPKVVFKTRI--YHCNV 112 >ref|XP_015062053.1| PREDICTED: constitutive photomorphogenesis protein 10 [Solanum pennellii] Length = 182 Score = 63.9 bits (154), Expect = 5e-09 Identities = 30/39 (76%), Positives = 31/39 (79%) Frame = +1 Query: 1 GTPYEGGIFFLDITFPSDYPFKPPKVMLSLLINRIHCIV 117 GTPYEGGIFFLDITFPSDYPFKPPKV+ I HC V Sbjct: 77 GTPYEGGIFFLDITFPSDYPFKPPKVVFKTRI--YHCNV 113 >ref|XP_012844247.1| PREDICTED: constitutive photomorphogenesis protein 10 [Erythranthe guttata] Length = 185 Score = 63.9 bits (154), Expect = 5e-09 Identities = 30/39 (76%), Positives = 31/39 (79%) Frame = +1 Query: 1 GTPYEGGIFFLDITFPSDYPFKPPKVMLSLLINRIHCIV 117 GTPYEGGIFFLDITFPSDYPFKPPKV+ I HC V Sbjct: 80 GTPYEGGIFFLDITFPSDYPFKPPKVVFKTRI--YHCNV 116 >ref|XP_011089731.1| PREDICTED: constitutive photomorphogenesis protein 10 [Sesamum indicum] Length = 185 Score = 63.9 bits (154), Expect = 5e-09 Identities = 30/39 (76%), Positives = 31/39 (79%) Frame = +1 Query: 1 GTPYEGGIFFLDITFPSDYPFKPPKVMLSLLINRIHCIV 117 GTPYEGGIFFLDITFPSDYPFKPPKV+ I HC V Sbjct: 80 GTPYEGGIFFLDITFPSDYPFKPPKVVFKTRI--YHCNV 116 >ref|XP_010651365.1| PREDICTED: constitutive photomorphogenesis protein 10 isoform X1 [Vitis vinifera] Length = 194 Score = 63.9 bits (154), Expect = 6e-09 Identities = 30/39 (76%), Positives = 31/39 (79%) Frame = +1 Query: 1 GTPYEGGIFFLDITFPSDYPFKPPKVMLSLLINRIHCIV 117 GTPYEGGIFFLDITFPSDYPFKPPKV+ I HC V Sbjct: 71 GTPYEGGIFFLDITFPSDYPFKPPKVVFKTRI--YHCNV 107 >ref|XP_009778466.1| PREDICTED: constitutive photomorphogenesis protein 10 [Nicotiana sylvestris] Length = 176 Score = 62.8 bits (151), Expect = 1e-08 Identities = 29/39 (74%), Positives = 31/39 (79%) Frame = +1 Query: 1 GTPYEGGIFFLDITFPSDYPFKPPKVMLSLLINRIHCIV 117 GTPYEGGI+FLDITFPSDYPFKPPKV+ I HC V Sbjct: 71 GTPYEGGIYFLDITFPSDYPFKPPKVVFKTRI--YHCNV 107 >ref|XP_009631838.1| PREDICTED: constitutive photomorphogenesis protein 10 [Nicotiana tomentosiformis] Length = 176 Score = 62.8 bits (151), Expect = 1e-08 Identities = 29/39 (74%), Positives = 31/39 (79%) Frame = +1 Query: 1 GTPYEGGIFFLDITFPSDYPFKPPKVMLSLLINRIHCIV 117 GTPYEGGI+FLDITFPSDYPFKPPKV+ I HC V Sbjct: 71 GTPYEGGIYFLDITFPSDYPFKPPKVVFKTRI--YHCNV 107 >ref|XP_007014687.1| Ubiquitin-conjugating enzyme family protein isoform 1 [Theobroma cacao] gi|508785050|gb|EOY32306.1| Ubiquitin-conjugating enzyme family protein isoform 1 [Theobroma cacao] Length = 176 Score = 62.8 bits (151), Expect = 1e-08 Identities = 29/39 (74%), Positives = 31/39 (79%) Frame = +1 Query: 1 GTPYEGGIFFLDITFPSDYPFKPPKVMLSLLINRIHCIV 117 GTPY+GGIFFLDITFPSDYPFKPPKV+ I HC V Sbjct: 71 GTPYQGGIFFLDITFPSDYPFKPPKVVFKTRI--YHCNV 107 >ref|XP_012067117.1| PREDICTED: constitutive photomorphogenesis protein 10 [Jatropha curcas] gi|643735544|gb|KDP42117.1| hypothetical protein JCGZ_01905 [Jatropha curcas] Length = 178 Score = 62.8 bits (151), Expect = 1e-08 Identities = 29/39 (74%), Positives = 31/39 (79%) Frame = +1 Query: 1 GTPYEGGIFFLDITFPSDYPFKPPKVMLSLLINRIHCIV 117 GTPY+GGIFFLDITFPSDYPFKPPKV+ I HC V Sbjct: 73 GTPYQGGIFFLDITFPSDYPFKPPKVVFKTRI--YHCNV 109 >ref|XP_002527080.1| PREDICTED: constitutive photomorphogenesis protein 10 [Ricinus communis] gi|1000950433|ref|XP_015579601.1| PREDICTED: constitutive photomorphogenesis protein 10 [Ricinus communis] gi|223533585|gb|EEF35324.1| ubiquitin-conjugating enzyme E2, putative [Ricinus communis] Length = 181 Score = 62.8 bits (151), Expect = 1e-08 Identities = 29/39 (74%), Positives = 31/39 (79%) Frame = +1 Query: 1 GTPYEGGIFFLDITFPSDYPFKPPKVMLSLLINRIHCIV 117 GTPYEGGIFFLDITFP+DYPFKPPKV+ I HC V Sbjct: 76 GTPYEGGIFFLDITFPTDYPFKPPKVVFKTRI--YHCNV 112 >gb|EPS67366.1| hypothetical protein M569_07410, partial [Genlisea aurea] Length = 163 Score = 62.0 bits (149), Expect = 2e-08 Identities = 29/39 (74%), Positives = 30/39 (76%) Frame = +1 Query: 1 GTPYEGGIFFLDITFPSDYPFKPPKVMLSLLINRIHCIV 117 GTPYEGGIFFLDI FPSDYPFKPPKV+ I HC V Sbjct: 58 GTPYEGGIFFLDIAFPSDYPFKPPKVVFKTRI--YHCNV 94 >gb|KJB66086.1| hypothetical protein B456_010G126700 [Gossypium raimondii] Length = 132 Score = 61.2 bits (147), Expect = 2e-08 Identities = 28/39 (71%), Positives = 31/39 (79%) Frame = +1 Query: 1 GTPYEGGIFFLDITFPSDYPFKPPKVMLSLLINRIHCIV 117 GTPY+GGIFFLDITFPSDYPF+PPKV+ I HC V Sbjct: 70 GTPYQGGIFFLDITFPSDYPFQPPKVVFKTRI--YHCNV 106 >gb|KJB66083.1| hypothetical protein B456_010G126700 [Gossypium raimondii] Length = 137 Score = 61.2 bits (147), Expect = 2e-08 Identities = 28/39 (71%), Positives = 31/39 (79%) Frame = +1 Query: 1 GTPYEGGIFFLDITFPSDYPFKPPKVMLSLLINRIHCIV 117 GTPY+GGIFFLDITFPSDYPF+PPKV+ I HC V Sbjct: 70 GTPYQGGIFFLDITFPSDYPFQPPKVVFKTRI--YHCNV 106 >ref|XP_012451042.1| PREDICTED: constitutive photomorphogenesis protein 10 isoform X2 [Gossypium raimondii] gi|763799133|gb|KJB66088.1| hypothetical protein B456_010G126700 [Gossypium raimondii] Length = 141 Score = 61.2 bits (147), Expect = 2e-08 Identities = 28/39 (71%), Positives = 31/39 (79%) Frame = +1 Query: 1 GTPYEGGIFFLDITFPSDYPFKPPKVMLSLLINRIHCIV 117 GTPY+GGIFFLDITFPSDYPF+PPKV+ I HC V Sbjct: 70 GTPYQGGIFFLDITFPSDYPFQPPKVVFKTRI--YHCNV 106 >ref|XP_002299458.2| hypothetical protein POPTR_0001s10830g [Populus trichocarpa] gi|550346982|gb|EEE84263.2| hypothetical protein POPTR_0001s10830g [Populus trichocarpa] Length = 177 Score = 62.0 bits (149), Expect = 2e-08 Identities = 28/39 (71%), Positives = 31/39 (79%) Frame = +1 Query: 1 GTPYEGGIFFLDITFPSDYPFKPPKVMLSLLINRIHCIV 117 GTPY+GGIFFLD+TFPSDYPFKPPKV+ I HC V Sbjct: 72 GTPYQGGIFFLDLTFPSDYPFKPPKVVFKTRI--YHCNV 108 >gb|KJB66085.1| hypothetical protein B456_010G126700 [Gossypium raimondii] Length = 144 Score = 61.2 bits (147), Expect = 2e-08 Identities = 28/39 (71%), Positives = 31/39 (79%) Frame = +1 Query: 1 GTPYEGGIFFLDITFPSDYPFKPPKVMLSLLINRIHCIV 117 GTPY+GGIFFLDITFPSDYPF+PPKV+ I HC V Sbjct: 70 GTPYQGGIFFLDITFPSDYPFQPPKVVFKTRI--YHCNV 106