BLASTX nr result
ID: Rehmannia27_contig00031934
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia27_contig00031934 (403 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011069610.1| PREDICTED: WAT1-related protein At1g43650-li... 58 2e-07 ref|XP_012829506.1| PREDICTED: WAT1-related protein At1g43650-li... 57 5e-07 ref|XP_012829505.1| PREDICTED: WAT1-related protein At1g43650-li... 57 5e-07 ref|XP_011101560.1| PREDICTED: WAT1-related protein At1g43650-li... 57 6e-07 emb|CDP12016.1| unnamed protein product [Coffea canephora] 54 8e-06 >ref|XP_011069610.1| PREDICTED: WAT1-related protein At1g43650-like [Sesamum indicum] Length = 338 Score = 58.2 bits (139), Expect = 2e-07 Identities = 34/72 (47%), Positives = 43/72 (59%), Gaps = 8/72 (11%) Frame = +3 Query: 210 GAKRRFLKQCSLY*LFILVF---MPMQVTNLQ**WKIILQ-----GIVVTGINYWLQAWV 365 G R + QCS L ++ M +T+ + W I L GI+VTGI+YWLQAWV Sbjct: 184 GKLRLMILQCSFSLLTTTIYGAAMERNLTSWKLAWNIQLLSVAYCGIMVTGISYWLQAWV 243 Query: 366 IEKKGPVFSAIF 401 IEKKGPVF+ IF Sbjct: 244 IEKKGPVFTVIF 255 >ref|XP_012829506.1| PREDICTED: WAT1-related protein At1g43650-like isoform X2 [Erythranthe guttata] Length = 339 Score = 57.0 bits (136), Expect = 5e-07 Identities = 23/27 (85%), Positives = 27/27 (100%) Frame = +3 Query: 321 GIVVTGINYWLQAWVIEKKGPVFSAIF 401 GI+VTG++YWLQAW+IEKKGPVFSAIF Sbjct: 233 GIIVTGLSYWLQAWIIEKKGPVFSAIF 259 >ref|XP_012829505.1| PREDICTED: WAT1-related protein At1g43650-like isoform X1 [Erythranthe guttata] gi|604297173|gb|EYU17437.1| hypothetical protein MIMGU_mgv1a008849mg [Erythranthe guttata] Length = 360 Score = 57.0 bits (136), Expect = 5e-07 Identities = 23/27 (85%), Positives = 27/27 (100%) Frame = +3 Query: 321 GIVVTGINYWLQAWVIEKKGPVFSAIF 401 GI+VTG++YWLQAW+IEKKGPVFSAIF Sbjct: 254 GIIVTGLSYWLQAWIIEKKGPVFSAIF 280 >ref|XP_011101560.1| PREDICTED: WAT1-related protein At1g43650-like [Sesamum indicum] Length = 358 Score = 56.6 bits (135), Expect = 6e-07 Identities = 24/31 (77%), Positives = 28/31 (90%) Frame = +3 Query: 309 IILQGIVVTGINYWLQAWVIEKKGPVFSAIF 401 I+ G++VTGI YWLQAWVIE+KGPVFSAIF Sbjct: 248 ILYCGVIVTGITYWLQAWVIEQKGPVFSAIF 278 >emb|CDP12016.1| unnamed protein product [Coffea canephora] Length = 344 Score = 53.5 bits (127), Expect = 8e-06 Identities = 21/27 (77%), Positives = 26/27 (96%) Frame = +3 Query: 321 GIVVTGINYWLQAWVIEKKGPVFSAIF 401 GIVVTG++YWLQ WV++KKGPVF+AIF Sbjct: 284 GIVVTGLSYWLQVWVVDKKGPVFTAIF 310