BLASTX nr result
ID: Rehmannia27_contig00031886
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia27_contig00031886 (952 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011081309.1| PREDICTED: probable glycosyltransferase At5g... 52 5e-12 ref|XP_012827295.1| PREDICTED: probable glycosyltransferase At5g... 47 9e-06 >ref|XP_011081309.1| PREDICTED: probable glycosyltransferase At5g03795 [Sesamum indicum] gi|747069059|ref|XP_011081310.1| PREDICTED: probable glycosyltransferase At5g03795 [Sesamum indicum] Length = 519 Score = 52.4 bits (124), Expect(2) = 5e-12 Identities = 25/35 (71%), Positives = 27/35 (77%) Frame = +1 Query: 781 AISPYKPLNTAVHLGTSHSLAVGVQLETVRDATIL 885 AIS Y PLNTAVHLG SH LA GV LET+RD I+ Sbjct: 54 AISSYLPLNTAVHLGKSHLLAAGVHLETIRDTPIM 88 Score = 47.0 bits (110), Expect(2) = 5e-12 Identities = 20/24 (83%), Positives = 24/24 (100%) Frame = +2 Query: 683 MTKLLRTIIVFLMFRIDWRKLFLV 754 MTKLLRTI++FL+F+IDWRKLFLV Sbjct: 1 MTKLLRTILIFLIFKIDWRKLFLV 24 >ref|XP_012827295.1| PREDICTED: probable glycosyltransferase At5g03795, partial [Erythranthe guttata] Length = 534 Score = 47.4 bits (111), Expect(2) = 9e-06 Identities = 22/29 (75%), Positives = 24/29 (82%) Frame = +1 Query: 784 ISPYKPLNTAVHLGTSHSLAVGVQLETVR 870 IS YKPLNT +H+G SHSLAVG LETVR Sbjct: 60 ISSYKPLNTTLHIGQSHSLAVGPPLETVR 88 Score = 30.8 bits (68), Expect(2) = 9e-06 Identities = 19/52 (36%), Positives = 29/52 (55%) Frame = +3 Query: 516 QNRSFLLTRTGHAGSAQRLHQSTKWILGGLHV*FVQFPMLDL*SMSLPRKLI 671 +++ FL + T HAG+AQ LHQS K + L +P+ D +S P K + Sbjct: 15 ESKFFLRSNTRHAGTAQILHQSAKSSISSL-----PYPLADW--ISPPHKTV 59