BLASTX nr result
ID: Rehmannia27_contig00031750
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia27_contig00031750 (411 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011081936.1| PREDICTED: pentatricopeptide repeat-containi... 186 3e-52 gb|EYU21955.1| hypothetical protein MIMGU_mgv1a001349mg [Erythra... 156 1e-41 ref|XP_012855980.1| PREDICTED: pentatricopeptide repeat-containi... 156 1e-41 emb|CDP04793.1| unnamed protein product [Coffea canephora] 111 5e-26 ref|XP_010094870.1| hypothetical protein L484_016452 [Morus nota... 98 3e-21 emb|CBI21003.3| unnamed protein product [Vitis vinifera] 97 6e-21 ref|XP_003631789.1| PREDICTED: pentatricopeptide repeat-containi... 97 6e-21 ref|XP_010648635.1| PREDICTED: pentatricopeptide repeat-containi... 97 7e-21 ref|XP_008370080.1| PREDICTED: pentatricopeptide repeat-containi... 94 1e-19 ref|XP_015965658.1| PREDICTED: pentatricopeptide repeat-containi... 91 7e-19 ref|XP_009377786.1| PREDICTED: pentatricopeptide repeat-containi... 91 1e-18 ref|XP_015877414.1| PREDICTED: pentatricopeptide repeat-containi... 89 6e-18 ref|XP_006450492.1| hypothetical protein CICLE_v10010816mg [Citr... 88 8e-18 ref|XP_002309609.2| pentatricopeptide repeat-containing family p... 87 3e-17 ref|XP_009784742.1| PREDICTED: pentatricopeptide repeat-containi... 87 3e-17 ref|XP_007013815.1| Pentatricopeptide repeat superfamily protein... 86 4e-17 gb|KDO61668.1| hypothetical protein CISIN_1g043440mg, partial [C... 85 9e-17 ref|XP_009615415.1| PREDICTED: pentatricopeptide repeat-containi... 85 9e-17 ref|XP_008243860.1| PREDICTED: pentatricopeptide repeat-containi... 85 1e-16 ref|XP_004514126.1| PREDICTED: pentatricopeptide repeat-containi... 84 2e-16 >ref|XP_011081936.1| PREDICTED: pentatricopeptide repeat-containing protein At3g54980, mitochondrial-like [Sesamum indicum] gi|747070249|ref|XP_011081937.1| PREDICTED: pentatricopeptide repeat-containing protein At3g54980, mitochondrial-like [Sesamum indicum] gi|747070251|ref|XP_011081938.1| PREDICTED: pentatricopeptide repeat-containing protein At3g54980, mitochondrial-like [Sesamum indicum] gi|747070253|ref|XP_011081939.1| PREDICTED: pentatricopeptide repeat-containing protein At3g54980, mitochondrial-like [Sesamum indicum] Length = 859 Score = 186 bits (471), Expect = 3e-52 Identities = 90/118 (76%), Positives = 104/118 (88%) Frame = +1 Query: 58 IPLPNSDSIEANPSPESQNSIKTETFQTPISENTRLSQAFVVDTLLSHINDPSSALEYFK 237 +P+ +SDS+EANP+ E QNSIK +TFQ P ++NTRLSQ +VVDTLLSHINDP +ALEYF+ Sbjct: 44 VPVRSSDSVEANPASEPQNSIKIQTFQNPFADNTRLSQIYVVDTLLSHINDPLAALEYFR 103 Query: 238 WVEKQRGFVREIGDSFFVLIHILVSSRNHHASVRNLLNNYLSGDFAPSGAVLVDRLIN 411 VEKQ GFVREIGDSFFVL+HILVSSR+HH + RNLLNNYLSGD APSG VLVDRLIN Sbjct: 104 SVEKQPGFVREIGDSFFVLLHILVSSRDHHGAARNLLNNYLSGDSAPSGVVLVDRLIN 161 >gb|EYU21955.1| hypothetical protein MIMGU_mgv1a001349mg [Erythranthe guttata] Length = 836 Score = 156 bits (394), Expect = 1e-41 Identities = 78/103 (75%), Positives = 85/103 (82%) Frame = +1 Query: 103 ESQNSIKTETFQTPISENTRLSQAFVVDTLLSHINDPSSALEYFKWVEKQRGFVREIGDS 282 E QN IK +TFQ PISEN RLSQA VV+TLLS+ NDP SAL+YF+W EKQRGFVREIGDS Sbjct: 49 EPQNPIKIQTFQKPISENPRLSQANVVETLLSNFNDPRSALDYFRWAEKQRGFVREIGDS 108 Query: 283 FFVLIHILVSSRNHHASVRNLLNNYLSGDFAPSGAVLVDRLIN 411 F VL+HILVSS HH S RNLLNNYLS D APSG VLV RLI+ Sbjct: 109 FLVLLHILVSSHYHHGSARNLLNNYLSSDSAPSGGVLVQRLID 151 >ref|XP_012855980.1| PREDICTED: pentatricopeptide repeat-containing protein At3g54980, mitochondrial [Erythranthe guttata] Length = 849 Score = 156 bits (394), Expect = 1e-41 Identities = 78/103 (75%), Positives = 85/103 (82%) Frame = +1 Query: 103 ESQNSIKTETFQTPISENTRLSQAFVVDTLLSHINDPSSALEYFKWVEKQRGFVREIGDS 282 E QN IK +TFQ PISEN RLSQA VV+TLLS+ NDP SAL+YF+W EKQRGFVREIGDS Sbjct: 49 EPQNPIKIQTFQKPISENPRLSQANVVETLLSNFNDPRSALDYFRWAEKQRGFVREIGDS 108 Query: 283 FFVLIHILVSSRNHHASVRNLLNNYLSGDFAPSGAVLVDRLIN 411 F VL+HILVSS HH S RNLLNNYLS D APSG VLV RLI+ Sbjct: 109 FLVLLHILVSSHYHHGSARNLLNNYLSSDSAPSGGVLVQRLID 151 >emb|CDP04793.1| unnamed protein product [Coffea canephora] Length = 856 Score = 111 bits (278), Expect = 5e-26 Identities = 58/118 (49%), Positives = 82/118 (69%), Gaps = 5/118 (4%) Frame = +1 Query: 73 SDSIEANPSPESQNSIK-----TETFQTPISENTRLSQAFVVDTLLSHINDPSSALEYFK 237 SDS + + +PE + I+ E ++ PISEN LSQ VV++LLSH NDP++A +YF+ Sbjct: 42 SDS-QGSKNPEFSSKIQILSNLNENWKKPISENPGLSQTHVVESLLSHRNDPAAAFKYFQ 100 Query: 238 WVEKQRGFVREIGDSFFVLIHILVSSRNHHASVRNLLNNYLSGDFAPSGAVLVDRLIN 411 W E QRGF+R + D + VL+HILVSS N ++ R LLN+Y+S D +PSG +L D LI+ Sbjct: 101 WAEGQRGFLRGVSDPYCVLLHILVSSPNEYSLTRRLLNSYVSSDSSPSGILLFDHLIS 158 >ref|XP_010094870.1| hypothetical protein L484_016452 [Morus notabilis] gi|587868026|gb|EXB57399.1| hypothetical protein L484_016452 [Morus notabilis] Length = 907 Score = 97.8 bits (242), Expect = 3e-21 Identities = 49/88 (55%), Positives = 65/88 (73%) Frame = +1 Query: 148 SENTRLSQAFVVDTLLSHINDPSSALEYFKWVEKQRGFVREIGDSFFVLIHILVSSRNHH 327 S +T L+QA V++TLLSH NDP SAL+YFKW E+ RGF+R + DSF VL+HIL+ S+ H Sbjct: 79 SLSTDLTQAHVINTLLSHKNDPYSALKYFKWAERMRGFIRGV-DSFSVLLHILMGSQETH 137 Query: 328 ASVRNLLNNYLSGDFAPSGAVLVDRLIN 411 S ++LL+ Y+SGD PS V VD L + Sbjct: 138 GSAQSLLSLYVSGDSGPSANVFVDHLFD 165 >emb|CBI21003.3| unnamed protein product [Vitis vinifera] Length = 837 Score = 97.1 bits (240), Expect = 6e-21 Identities = 54/109 (49%), Positives = 68/109 (62%), Gaps = 1/109 (0%) Frame = +1 Query: 88 ANPSPE-SQNSIKTETFQTPISENTRLSQAFVVDTLLSHINDPSSALEYFKWVEKQRGFV 264 ++P P SQ+++ T E T LSQ V+D LL H+NDP SAL YFK E QRGF+ Sbjct: 35 SSPYPRYSQDTVPTSQIH---QETTPLSQNHVIDALLCHVNDPQSALRYFKRAETQRGFI 91 Query: 265 REIGDSFFVLIHILVSSRNHHASVRNLLNNYLSGDFAPSGAVLVDRLIN 411 R + D++ VL+HIL+ S H R LLN Y+SGD PS V VD LIN Sbjct: 92 RGV-DAYCVLLHILMRSPETHGHARKLLNRYVSGDSDPSPVVFVDHLIN 139 >ref|XP_003631789.1| PREDICTED: pentatricopeptide repeat-containing protein At3g54980, mitochondrial-like isoform X1 [Vitis vinifera] gi|731385776|ref|XP_010648630.1| PREDICTED: pentatricopeptide repeat-containing protein At3g54980, mitochondrial-like isoform X1 [Vitis vinifera] gi|731385778|ref|XP_010648631.1| PREDICTED: pentatricopeptide repeat-containing protein At3g54980, mitochondrial-like isoform X1 [Vitis vinifera] gi|731385781|ref|XP_010648632.1| PREDICTED: pentatricopeptide repeat-containing protein At3g54980, mitochondrial-like isoform X1 [Vitis vinifera] gi|731385783|ref|XP_010648633.1| PREDICTED: pentatricopeptide repeat-containing protein At3g54980, mitochondrial-like isoform X1 [Vitis vinifera] gi|731385785|ref|XP_010648634.1| PREDICTED: pentatricopeptide repeat-containing protein At3g54980, mitochondrial-like isoform X1 [Vitis vinifera] Length = 877 Score = 97.1 bits (240), Expect = 6e-21 Identities = 54/109 (49%), Positives = 68/109 (62%), Gaps = 1/109 (0%) Frame = +1 Query: 88 ANPSPE-SQNSIKTETFQTPISENTRLSQAFVVDTLLSHINDPSSALEYFKWVEKQRGFV 264 ++P P SQ+++ T E T LSQ V+D LL H+NDP SAL YFK E QRGF+ Sbjct: 75 SSPYPRYSQDTVPTSQIH---QETTPLSQNHVIDALLCHVNDPQSALRYFKRAETQRGFI 131 Query: 265 REIGDSFFVLIHILVSSRNHHASVRNLLNNYLSGDFAPSGAVLVDRLIN 411 R + D++ VL+HIL+ S H R LLN Y+SGD PS V VD LIN Sbjct: 132 RGV-DAYCVLLHILMRSPETHGHARKLLNRYVSGDSDPSPVVFVDHLIN 179 >ref|XP_010648635.1| PREDICTED: pentatricopeptide repeat-containing protein At3g54980, mitochondrial-like isoform X3 [Vitis vinifera] Length = 1204 Score = 97.1 bits (240), Expect = 7e-21 Identities = 54/109 (49%), Positives = 68/109 (62%), Gaps = 1/109 (0%) Frame = +1 Query: 88 ANPSPE-SQNSIKTETFQTPISENTRLSQAFVVDTLLSHINDPSSALEYFKWVEKQRGFV 264 ++P P SQ+++ T E T LSQ V+D LL H+NDP SAL YFK E QRGF+ Sbjct: 402 SSPYPRYSQDTVPTSQIH---QETTPLSQNHVIDALLCHVNDPQSALRYFKRAETQRGFI 458 Query: 265 REIGDSFFVLIHILVSSRNHHASVRNLLNNYLSGDFAPSGAVLVDRLIN 411 R + D++ VL+HIL+ S H R LLN Y+SGD PS V VD LIN Sbjct: 459 RGV-DAYCVLLHILMRSPETHGHARKLLNRYVSGDSDPSPVVFVDHLIN 506 >ref|XP_008370080.1| PREDICTED: pentatricopeptide repeat-containing protein At2g39230, mitochondrial-like [Malus domestica] Length = 860 Score = 93.6 bits (231), Expect = 1e-19 Identities = 49/110 (44%), Positives = 72/110 (65%) Frame = +1 Query: 82 IEANPSPESQNSIKTETFQTPISENTRLSQAFVVDTLLSHINDPSSALEYFKWVEKQRGF 261 IE + +P + + + E F PIS+++ L+Q V+ TLLSH + P SA++YFKW E++RG Sbjct: 62 IEFHENPVASDPNQGE-FAAPISQDSELTQTSVISTLLSHKSKPYSAIKYFKWAERERGL 120 Query: 262 VREIGDSFFVLIHILVSSRNHHASVRNLLNNYLSGDFAPSGAVLVDRLIN 411 VR + D+ VL+HIL+ S N H + LLN Y+SGD P V VD L++ Sbjct: 121 VRGV-DAVCVLLHILMGSPNTHERAKMLLNQYVSGDSGPVPGVFVDHLVD 169 >ref|XP_015965658.1| PREDICTED: pentatricopeptide repeat-containing protein At3g54980, mitochondrial [Arachis duranensis] Length = 881 Score = 91.3 bits (225), Expect = 7e-19 Identities = 53/121 (43%), Positives = 76/121 (62%), Gaps = 5/121 (4%) Frame = +1 Query: 61 PLPNSDSIEANPSPESQNSIKTETFQTPISENTR-----LSQAFVVDTLLSHINDPSSAL 225 PLP+S S + P S S K + F IS + +S+ V+DTLLSH DP SAL Sbjct: 66 PLPHSQSQDPANGPSSHFSKKIDDFPMKISAEAQSHLEVISKEGVLDTLLSHKLDPKSAL 125 Query: 226 EYFKWVEKQRGFVREIGDSFFVLIHILVSSRNHHASVRNLLNNYLSGDFAPSGAVLVDRL 405 ++FK VE++RGFV+ + D +L+HIL SS + + +RNLLNNY+ D +P+ VLV+ L Sbjct: 126 KFFKGVERRRGFVKTV-DVLCLLVHILASSPDTYGVLRNLLNNYVFADSSPTVRVLVEEL 184 Query: 406 I 408 + Sbjct: 185 V 185 >ref|XP_009377786.1| PREDICTED: pentatricopeptide repeat-containing protein At3g54980, mitochondrial-like isoform X1 [Pyrus x bretschneideri] gi|694405904|ref|XP_009377787.1| PREDICTED: pentatricopeptide repeat-containing protein At3g54980, mitochondrial-like isoform X2 [Pyrus x bretschneideri] Length = 860 Score = 90.5 bits (223), Expect = 1e-18 Identities = 48/110 (43%), Positives = 71/110 (64%) Frame = +1 Query: 82 IEANPSPESQNSIKTETFQTPISENTRLSQAFVVDTLLSHINDPSSALEYFKWVEKQRGF 261 IE + +P + + + E F P S+++ L+Q V+ TLLSH + P SA++YFKW E++RGF Sbjct: 62 IEFHENPVASDPNQGE-FAAPTSQDSELTQTSVISTLLSHKSKPYSAVKYFKWAERERGF 120 Query: 262 VREIGDSFFVLIHILVSSRNHHASVRNLLNNYLSGDFAPSGAVLVDRLIN 411 VR + D+ VL+HIL+ S N + LLN Y+SGD P V VD L++ Sbjct: 121 VRGV-DAVCVLLHILMGSPNTQERAKMLLNQYVSGDSGPVPGVFVDHLVD 169 >ref|XP_015877414.1| PREDICTED: pentatricopeptide repeat-containing protein At3g54980, mitochondrial-like [Ziziphus jujuba] gi|1009107011|ref|XP_015877421.1| PREDICTED: pentatricopeptide repeat-containing protein At3g54980, mitochondrial-like [Ziziphus jujuba] Length = 820 Score = 88.6 bits (218), Expect = 6e-18 Identities = 49/105 (46%), Positives = 70/105 (66%) Frame = +1 Query: 97 SPESQNSIKTETFQTPISENTRLSQAFVVDTLLSHINDPSSALEYFKWVEKQRGFVREIG 276 +P S +S+ ++T +P S++ + A V++TLLSH +DP SA YFKW EK RGFV+ I Sbjct: 20 NPHSVSSL-SQTPSSPDSKDHDFTPANVINTLLSHRSDPRSAFTYFKWAEKMRGFVKAI- 77 Query: 277 DSFFVLIHILVSSRNHHASVRNLLNNYLSGDFAPSGAVLVDRLIN 411 D F VL+H+L+ S + H + RNLLN Y+S D PS V V L++ Sbjct: 78 DVFCVLLHVLMGSPDTHGAARNLLNQYVSSDSGPS-LVFVHNLVD 121 >ref|XP_006450492.1| hypothetical protein CICLE_v10010816mg [Citrus clementina] gi|568859583|ref|XP_006483317.1| PREDICTED: pentatricopeptide repeat-containing protein At3g54980, mitochondrial-like [Citrus sinensis] gi|557553718|gb|ESR63732.1| hypothetical protein CICLE_v10010816mg [Citrus clementina] Length = 850 Score = 88.2 bits (217), Expect = 8e-18 Identities = 55/141 (39%), Positives = 78/141 (55%), Gaps = 25/141 (17%) Frame = +1 Query: 61 PLPNSDSIEANPSPESQNSIKTETFQTPISEN-------------------------TRL 165 P N+ SI + P Q+S K + ++P+SEN T L Sbjct: 17 PFKNTKSICSQP----QSSEKPISSESPVSENFPEKITKGSHFSGNPIFPESNTFQPTDL 72 Query: 166 SQAFVVDTLLSHINDPSSALEYFKWVEKQRGFVREIGDSFFVLIHILVSSRNHHASVRNL 345 SQ V+ +LLS N+P SA EYFK VE++RGF++ + D+F VL+HIL+ R H RNL Sbjct: 73 SQTSVISSLLSCRNEPVSAFEYFKRVERRRGFLKSL-DTFCVLLHILMKDRESHRYARNL 131 Query: 346 LNNYLSGDFAPSGAVLVDRLI 408 LN+Y+SG P+ A ++D LI Sbjct: 132 LNHYVSGGSEPTSAAIIDHLI 152 >ref|XP_002309609.2| pentatricopeptide repeat-containing family protein [Populus trichocarpa] gi|550337148|gb|EEE93132.2| pentatricopeptide repeat-containing family protein [Populus trichocarpa] Length = 841 Score = 86.7 bits (213), Expect = 3e-17 Identities = 47/117 (40%), Positives = 67/117 (57%), Gaps = 3/117 (2%) Frame = +1 Query: 67 PNSDSIEANPSPESQNSIKTETF---QTPISENTRLSQAFVVDTLLSHINDPSSALEYFK 237 P +I + +P SQN F P S+++ L+Q +DTLL+H NDP SAL YF Sbjct: 27 PELPNIPISETPLSQNPHPNTNFPGKSAPTSQDSFLTQTQYIDTLLNHQNDPQSALSYFT 86 Query: 238 WVEKQRGFVREIGDSFFVLIHILVSSRNHHASVRNLLNNYLSGDFAPSGAVLVDRLI 408 W ++RG ++ + D+ VL+HIL S RNLLN + S D+ P +V+V RLI Sbjct: 87 WASQKRGLIKSV-DALCVLLHILTKSTETCGKARNLLNRFASDDWGPVPSVVVSRLI 142 >ref|XP_009784742.1| PREDICTED: pentatricopeptide repeat-containing protein At3g54980, mitochondrial-like [Nicotiana sylvestris] gi|698474596|ref|XP_009784743.1| PREDICTED: pentatricopeptide repeat-containing protein At3g54980, mitochondrial-like [Nicotiana sylvestris] gi|698474598|ref|XP_009784744.1| PREDICTED: pentatricopeptide repeat-containing protein At3g54980, mitochondrial-like [Nicotiana sylvestris] gi|698474601|ref|XP_009784745.1| PREDICTED: pentatricopeptide repeat-containing protein At3g54980, mitochondrial-like [Nicotiana sylvestris] Length = 864 Score = 86.7 bits (213), Expect = 3e-17 Identities = 44/90 (48%), Positives = 56/90 (62%) Frame = +1 Query: 142 PISENTRLSQAFVVDTLLSHINDPSSALEYFKWVEKQRGFVREIGDSFFVLIHILVSSRN 321 PISE+ ++ VVD LLSH +DP SA YF+ +QRGF+ D FFVL+HILVSS Sbjct: 76 PISEDGGFTKNHVVDVLLSHRDDPDSAYRYFQTARQQRGFLHTKSDPFFVLLHILVSSTM 135 Query: 322 HHASVRNLLNNYLSGDFAPSGAVLVDRLIN 411 H R LL+NY D PS V+ + L+N Sbjct: 136 HQHKARRLLDNYAFSDSGPSATVVFNGLVN 165 >ref|XP_007013815.1| Pentatricopeptide repeat superfamily protein, putative [Theobroma cacao] gi|508784178|gb|EOY31434.1| Pentatricopeptide repeat superfamily protein, putative [Theobroma cacao] Length = 1159 Score = 86.3 bits (212), Expect = 4e-17 Identities = 49/115 (42%), Positives = 74/115 (64%), Gaps = 2/115 (1%) Frame = +1 Query: 73 SDSIEANPSPES--QNSIKTETFQTPISENTRLSQAFVVDTLLSHINDPSSALEYFKWVE 246 S SI + SP S + K ++++T L++ V++TLL H N+P SAL+YF++VE Sbjct: 349 SKSISDSDSPGSLIPPTPKDPRLTPSLTQDTSLTRTHVINTLLIHRNNPESALKYFRFVE 408 Query: 247 KQRGFVREIGDSFFVLIHILVSSRNHHASVRNLLNNYLSGDFAPSGAVLVDRLIN 411 +RGFVR I D F VL+HILV S+ + V+ LLN +++GD P+ V +D LI+ Sbjct: 409 NKRGFVRSI-DVFCVLLHILVGSQQTNKQVKYLLNRFVAGDSGPTPIVFLDHLID 462 >gb|KDO61668.1| hypothetical protein CISIN_1g043440mg, partial [Citrus sinensis] Length = 850 Score = 85.1 bits (209), Expect = 9e-17 Identities = 43/84 (51%), Positives = 59/84 (70%) Frame = +1 Query: 157 TRLSQAFVVDTLLSHINDPSSALEYFKWVEKQRGFVREIGDSFFVLIHILVSSRNHHASV 336 T LSQ V+ +LLS N+P SA EYFK VE++RGF++ + D+F VL+HIL+ R H Sbjct: 2 TDLSQTSVISSLLSCRNEPVSAFEYFKRVERRRGFLKSL-DTFCVLLHILMKDRESHRYA 60 Query: 337 RNLLNNYLSGDFAPSGAVLVDRLI 408 RNLLN+Y+SG P+ A ++D LI Sbjct: 61 RNLLNHYVSGGSEPTSAAIIDHLI 84 >ref|XP_009615415.1| PREDICTED: pentatricopeptide repeat-containing protein At3g54980, mitochondrial-like [Nicotiana tomentosiformis] gi|697122855|ref|XP_009615416.1| PREDICTED: pentatricopeptide repeat-containing protein At3g54980, mitochondrial-like [Nicotiana tomentosiformis] gi|697122857|ref|XP_009615417.1| PREDICTED: pentatricopeptide repeat-containing protein At3g54980, mitochondrial-like [Nicotiana tomentosiformis] gi|697122859|ref|XP_009615418.1| PREDICTED: pentatricopeptide repeat-containing protein At3g54980, mitochondrial-like [Nicotiana tomentosiformis] Length = 864 Score = 85.1 bits (209), Expect = 9e-17 Identities = 52/123 (42%), Positives = 67/123 (54%), Gaps = 7/123 (5%) Frame = +1 Query: 64 LPNSDSIEANPSPESQNSIKT-------ETFQTPISENTRLSQAFVVDTLLSHINDPSSA 222 L SDS+E P Q+S K + P SE+ ++ VVD LLSH +DP SA Sbjct: 44 LSPSDSLE-KPILNPQDSEKLVPLHDIDHSCDRPNSEDGGFTKNHVVDVLLSHRDDPDSA 102 Query: 223 LEYFKWVEKQRGFVREIGDSFFVLIHILVSSRNHHASVRNLLNNYLSGDFAPSGAVLVDR 402 YF+ +QRGF+ D FFVL+HILVSS H R LL+NY D PS V+ + Sbjct: 103 YRYFQTARQQRGFLHTKSDPFFVLLHILVSSTMHQHKARRLLDNYAFSDSGPSATVIFNG 162 Query: 403 LIN 411 L+N Sbjct: 163 LVN 165 >ref|XP_008243860.1| PREDICTED: pentatricopeptide repeat-containing protein At3g54980, mitochondrial-like [Prunus mume] Length = 859 Score = 84.7 bits (208), Expect = 1e-16 Identities = 49/128 (38%), Positives = 71/128 (55%), Gaps = 12/128 (9%) Frame = +1 Query: 64 LPNSDSIEANPSPESQNSIKT------------ETFQTPISENTRLSQAFVVDTLLSHIN 207 L +S S NPS S S+ + E + ++ ++Q V+ TLLSH + Sbjct: 35 LESSLSKNPNPSTNSSQSVTSKSDFPEKATSEIEFHEDLFGRDSEITQTKVISTLLSHRS 94 Query: 208 DPSSALEYFKWVEKQRGFVREIGDSFFVLIHILVSSRNHHASVRNLLNNYLSGDFAPSGA 387 +P+SALE+F W EK+RGF++ + D+F VL+HIL H + LLN Y SGD P+ Sbjct: 95 EPNSALEHFIWAEKERGFLKGV-DAFCVLLHILTRFEETHVRAQILLNQYASGDSGPAQQ 153 Query: 388 VLVDRLIN 411 V DRLI+ Sbjct: 154 VFFDRLID 161 >ref|XP_004514126.1| PREDICTED: pentatricopeptide repeat-containing protein At3g54980, mitochondrial-like [Cicer arietinum] Length = 850 Score = 84.3 bits (207), Expect = 2e-16 Identities = 47/97 (48%), Positives = 68/97 (70%) Frame = +1 Query: 118 IKTETFQTPISENTRLSQAFVVDTLLSHINDPSSALEYFKWVEKQRGFVREIGDSFFVLI 297 I T F I +T SQ ++DTLL+H ++P SAL++FK VE++RGFV+ + D F +L+ Sbjct: 60 ISTPNFPEKII-STSNSQNQILDTLLTHKSNPKSALKFFKGVERKRGFVKTV-DVFSLLL 117 Query: 298 HILVSSRNHHASVRNLLNNYLSGDFAPSGAVLVDRLI 408 IL S+ H+S+RNLLNNY+ GD +PS VLV+ L+ Sbjct: 118 QILSSTPQTHSSLRNLLNNYVFGDSSPSPKVLVEHLL 154