BLASTX nr result
ID: Rehmannia27_contig00031697
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia27_contig00031697 (916 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value dbj|BAH56907.1| AT1G52300 [Arabidopsis thaliana] 71 2e-12 gb|KYP39752.1| 60S ribosomal protein L37-3, partial [Cajanus cajan] 66 9e-11 ref|XP_015161821.1| PREDICTED: 60S ribosomal protein L37-3-like ... 66 2e-10 ref|XP_009611259.1| PREDICTED: 60S ribosomal protein L37-3 [Nico... 66 2e-10 gb|EPS74476.1| hypothetical protein M569_00287, partial [Genlise... 66 2e-10 gb|EPS63391.1| hypothetical protein M569_11398, partial [Genlise... 66 2e-10 ref|XP_004241731.1| PREDICTED: 60S ribosomal protein L37-2 [Sola... 66 2e-10 ref|XP_012852830.1| PREDICTED: 60S ribosomal protein L37-3 [Eryt... 66 2e-10 ref|XP_012856774.1| PREDICTED: 60S ribosomal protein L37-3 [Eryt... 66 2e-10 gb|EPS70838.1| hypothetical protein M569_03921, partial [Genlise... 66 2e-10 ref|XP_013741030.1| PREDICTED: 60S ribosomal protein L37-2-like ... 65 3e-10 ref|XP_010500828.1| PREDICTED: 60S ribosomal protein L37-3-like ... 65 3e-10 ref|NP_172977.1| 60S ribosomal protein L37-1 [Arabidopsis thalia... 65 4e-10 ref|XP_010459048.1| PREDICTED: 60S ribosomal protein L37-1 [Came... 65 4e-10 ref|XP_010496951.1| PREDICTED: 60S ribosomal protein L37-1-like ... 65 4e-10 ref|XP_009144855.1| PREDICTED: 60S ribosomal protein L37-2 [Bras... 65 4e-10 ref|XP_009135475.1| PREDICTED: 60S ribosomal protein L37-2-like ... 65 4e-10 ref|NP_175640.1| 60S ribosomal protein L37-2 [Arabidopsis thalia... 65 4e-10 ref|XP_006406883.1| hypothetical protein EUTSA_v10021833mg [Eutr... 65 4e-10 ref|XP_006392937.1| hypothetical protein EUTSA_v10011894mg [Eutr... 65 4e-10 >dbj|BAH56907.1| AT1G52300 [Arabidopsis thaliana] Length = 78 Score = 70.9 bits (172), Expect = 2e-12 Identities = 30/31 (96%), Positives = 31/31 (100%) Frame = +3 Query: 3 LCVRCGRRSFHLQKSRCSACAYPAARKRTCT 95 LCVRCGRRSFH+QKSRCSACAYPAARKRTCT Sbjct: 18 LCVRCGRRSFHIQKSRCSACAYPAARKRTCT 48 >gb|KYP39752.1| 60S ribosomal protein L37-3, partial [Cajanus cajan] Length = 67 Score = 66.2 bits (160), Expect = 9e-11 Identities = 28/35 (80%), Positives = 31/35 (88%) Frame = +3 Query: 3 LCVRCGRRSFHLQKSRCSACAYPAARKRTCTAFCF 107 LCVRCGRRSFHLQKSRC+ACA+PAARKR C + F Sbjct: 18 LCVRCGRRSFHLQKSRCAACAFPAARKRKCNSSSF 52 >ref|XP_015161821.1| PREDICTED: 60S ribosomal protein L37-3-like [Solanum tuberosum] Length = 79 Score = 65.9 bits (159), Expect = 2e-10 Identities = 29/31 (93%), Positives = 30/31 (96%) Frame = +3 Query: 3 LCVRCGRRSFHLQKSRCSACAYPAARKRTCT 95 LCVRCGRRSFHLQKSRCSACAYPAARKR+ T Sbjct: 18 LCVRCGRRSFHLQKSRCSACAYPAARKRSYT 48 >ref|XP_009611259.1| PREDICTED: 60S ribosomal protein L37-3 [Nicotiana tomentosiformis] gi|698582716|ref|XP_009777906.1| PREDICTED: 60S ribosomal protein L37-3 [Nicotiana sylvestris] Length = 94 Score = 66.2 bits (160), Expect = 2e-10 Identities = 29/29 (100%), Positives = 29/29 (100%) Frame = +3 Query: 3 LCVRCGRRSFHLQKSRCSACAYPAARKRT 89 LCVRCGRRSFHLQKSRCSACAYPAARKRT Sbjct: 18 LCVRCGRRSFHLQKSRCSACAYPAARKRT 46 >gb|EPS74476.1| hypothetical protein M569_00287, partial [Genlisea aurea] Length = 94 Score = 66.2 bits (160), Expect = 2e-10 Identities = 29/29 (100%), Positives = 29/29 (100%) Frame = +3 Query: 3 LCVRCGRRSFHLQKSRCSACAYPAARKRT 89 LCVRCGRRSFHLQKSRCSACAYPAARKRT Sbjct: 17 LCVRCGRRSFHLQKSRCSACAYPAARKRT 45 >gb|EPS63391.1| hypothetical protein M569_11398, partial [Genlisea aurea] Length = 94 Score = 66.2 bits (160), Expect = 2e-10 Identities = 29/29 (100%), Positives = 29/29 (100%) Frame = +3 Query: 3 LCVRCGRRSFHLQKSRCSACAYPAARKRT 89 LCVRCGRRSFHLQKSRCSACAYPAARKRT Sbjct: 17 LCVRCGRRSFHLQKSRCSACAYPAARKRT 45 >ref|XP_004241731.1| PREDICTED: 60S ribosomal protein L37-2 [Solanum lycopersicum] gi|565379492|ref|XP_006356156.1| PREDICTED: 60S ribosomal protein L37-2 [Solanum tuberosum] gi|970035590|ref|XP_015079129.1| PREDICTED: 60S ribosomal protein L37-2 [Solanum pennellii] Length = 94 Score = 66.2 bits (160), Expect = 2e-10 Identities = 29/29 (100%), Positives = 29/29 (100%) Frame = +3 Query: 3 LCVRCGRRSFHLQKSRCSACAYPAARKRT 89 LCVRCGRRSFHLQKSRCSACAYPAARKRT Sbjct: 18 LCVRCGRRSFHLQKSRCSACAYPAARKRT 46 >ref|XP_012852830.1| PREDICTED: 60S ribosomal protein L37-3 [Erythranthe guttata] gi|604305555|gb|EYU24699.1| hypothetical protein MIMGU_mgv1a017069mg [Erythranthe guttata] Length = 95 Score = 66.2 bits (160), Expect = 2e-10 Identities = 29/29 (100%), Positives = 29/29 (100%) Frame = +3 Query: 3 LCVRCGRRSFHLQKSRCSACAYPAARKRT 89 LCVRCGRRSFHLQKSRCSACAYPAARKRT Sbjct: 18 LCVRCGRRSFHLQKSRCSACAYPAARKRT 46 >ref|XP_012856774.1| PREDICTED: 60S ribosomal protein L37-3 [Erythranthe guttata] gi|604301866|gb|EYU21452.1| hypothetical protein MIMGU_mgv1a017055mg [Erythranthe guttata] Length = 95 Score = 66.2 bits (160), Expect = 2e-10 Identities = 29/29 (100%), Positives = 29/29 (100%) Frame = +3 Query: 3 LCVRCGRRSFHLQKSRCSACAYPAARKRT 89 LCVRCGRRSFHLQKSRCSACAYPAARKRT Sbjct: 18 LCVRCGRRSFHLQKSRCSACAYPAARKRT 46 >gb|EPS70838.1| hypothetical protein M569_03921, partial [Genlisea aurea] Length = 93 Score = 65.9 bits (159), Expect = 2e-10 Identities = 28/29 (96%), Positives = 29/29 (100%) Frame = +3 Query: 3 LCVRCGRRSFHLQKSRCSACAYPAARKRT 89 LC+RCGRRSFHLQKSRCSACAYPAARKRT Sbjct: 17 LCIRCGRRSFHLQKSRCSACAYPAARKRT 45 >ref|XP_013741030.1| PREDICTED: 60S ribosomal protein L37-2-like [Brassica napus] Length = 93 Score = 65.5 bits (158), Expect = 3e-10 Identities = 28/29 (96%), Positives = 29/29 (100%) Frame = +3 Query: 3 LCVRCGRRSFHLQKSRCSACAYPAARKRT 89 LCVRCGRRSFH+QKSRCSACAYPAARKRT Sbjct: 18 LCVRCGRRSFHIQKSRCSACAYPAARKRT 46 >ref|XP_010500828.1| PREDICTED: 60S ribosomal protein L37-3-like [Camelina sativa] gi|727578764|ref|XP_010462067.1| PREDICTED: 60S ribosomal protein L37-3-like [Camelina sativa] gi|727614927|ref|XP_010479735.1| PREDICTED: 60S ribosomal protein L37-3-like [Camelina sativa] Length = 93 Score = 65.5 bits (158), Expect = 3e-10 Identities = 28/29 (96%), Positives = 29/29 (100%) Frame = +3 Query: 3 LCVRCGRRSFHLQKSRCSACAYPAARKRT 89 LCVRCGRRSFH+QKSRCSACAYPAARKRT Sbjct: 18 LCVRCGRRSFHIQKSRCSACAYPAARKRT 46 >ref|NP_172977.1| 60S ribosomal protein L37-1 [Arabidopsis thaliana] gi|75301386|sp|Q8LFH7.1|RL371_ARATH RecName: Full=60S ribosomal protein L37-1 gi|21537060|gb|AAM61401.1| putative 60s ribosomal protein L37 [Arabidopsis thaliana] gi|26452539|dbj|BAC43354.1| putative 60s ribosomal protein L37 [Arabidopsis thaliana] gi|28827304|gb|AAO50496.1| putative 60s ribosomal protein L37 [Arabidopsis thaliana] gi|332191174|gb|AEE29295.1| 60S ribosomal protein L37-1 [Arabidopsis thaliana] Length = 95 Score = 65.5 bits (158), Expect = 4e-10 Identities = 28/29 (96%), Positives = 29/29 (100%) Frame = +3 Query: 3 LCVRCGRRSFHLQKSRCSACAYPAARKRT 89 LCVRCGRRSFH+QKSRCSACAYPAARKRT Sbjct: 18 LCVRCGRRSFHIQKSRCSACAYPAARKRT 46 >ref|XP_010459048.1| PREDICTED: 60S ribosomal protein L37-1 [Camelina sativa] Length = 95 Score = 65.5 bits (158), Expect = 4e-10 Identities = 28/29 (96%), Positives = 29/29 (100%) Frame = +3 Query: 3 LCVRCGRRSFHLQKSRCSACAYPAARKRT 89 LCVRCGRRSFH+QKSRCSACAYPAARKRT Sbjct: 18 LCVRCGRRSFHIQKSRCSACAYPAARKRT 46 >ref|XP_010496951.1| PREDICTED: 60S ribosomal protein L37-1-like [Camelina sativa] Length = 95 Score = 65.5 bits (158), Expect = 4e-10 Identities = 28/29 (96%), Positives = 29/29 (100%) Frame = +3 Query: 3 LCVRCGRRSFHLQKSRCSACAYPAARKRT 89 LCVRCGRRSFH+QKSRCSACAYPAARKRT Sbjct: 18 LCVRCGRRSFHIQKSRCSACAYPAARKRT 46 >ref|XP_009144855.1| PREDICTED: 60S ribosomal protein L37-2 [Brassica rapa] gi|685314200|ref|XP_009147697.1| PREDICTED: 60S ribosomal protein L37-2 [Brassica rapa] gi|922442732|ref|XP_013626021.1| PREDICTED: 60S ribosomal protein L37-2 [Brassica oleracea var. oleracea] gi|922506952|ref|XP_013590225.1| PREDICTED: 60S ribosomal protein L37-2 [Brassica oleracea var. oleracea] gi|922507068|ref|XP_013590258.1| PREDICTED: 60S ribosomal protein L37-2 [Brassica oleracea var. oleracea] gi|923625934|ref|XP_013749020.1| PREDICTED: 60S ribosomal protein L37-2 [Brassica napus] gi|923638364|ref|XP_013640363.1| PREDICTED: 60S ribosomal protein L37-2 [Brassica napus] gi|923799539|ref|XP_013686923.1| PREDICTED: 60S ribosomal protein L37-2 [Brassica napus] gi|923801104|ref|XP_013687412.1| PREDICTED: 60S ribosomal protein L37-2 [Brassica napus] gi|923835445|ref|XP_013698988.1| PREDICTED: 60S ribosomal protein L37-2 [Brassica napus] gi|923893184|ref|XP_013717539.1| PREDICTED: 60S ribosomal protein L37-2 [Brassica napus] gi|923902100|ref|XP_013721356.1| PREDICTED: 60S ribosomal protein L37-2 [Brassica napus] gi|923909893|ref|XP_013724772.1| PREDICTED: 60S ribosomal protein L37-2 [Brassica napus] Length = 95 Score = 65.5 bits (158), Expect = 4e-10 Identities = 28/29 (96%), Positives = 29/29 (100%) Frame = +3 Query: 3 LCVRCGRRSFHLQKSRCSACAYPAARKRT 89 LCVRCGRRSFH+QKSRCSACAYPAARKRT Sbjct: 18 LCVRCGRRSFHIQKSRCSACAYPAARKRT 46 >ref|XP_009135475.1| PREDICTED: 60S ribosomal protein L37-2-like [Brassica rapa] Length = 95 Score = 65.5 bits (158), Expect = 4e-10 Identities = 28/29 (96%), Positives = 29/29 (100%) Frame = +3 Query: 3 LCVRCGRRSFHLQKSRCSACAYPAARKRT 89 LCVRCGRRSFH+QKSRCSACAYPAARKRT Sbjct: 18 LCVRCGRRSFHIQKSRCSACAYPAARKRT 46 >ref|NP_175640.1| 60S ribosomal protein L37-2 [Arabidopsis thaliana] gi|20143906|sp|Q43292.2|RL372_ARATH RecName: Full=60S ribosomal protein L37-2 gi|12323122|gb|AAG51542.1|AC037424_7 60S ribosomal protein L37, putative; 56921-57860 [Arabidopsis thaliana] gi|13877907|gb|AAK44031.1|AF370216_1 putative 60S ribosomal protein L37 [Arabidopsis thaliana] gi|21280805|gb|AAM44969.1| putative 60S ribosomal protein L37 [Arabidopsis thaliana] gi|222423584|dbj|BAH19761.1| AT1G52300 [Arabidopsis thaliana] gi|332194658|gb|AEE32779.1| 60S ribosomal protein L37-2 [Arabidopsis thaliana] Length = 95 Score = 65.5 bits (158), Expect = 4e-10 Identities = 28/29 (96%), Positives = 29/29 (100%) Frame = +3 Query: 3 LCVRCGRRSFHLQKSRCSACAYPAARKRT 89 LCVRCGRRSFH+QKSRCSACAYPAARKRT Sbjct: 18 LCVRCGRRSFHIQKSRCSACAYPAARKRT 46 >ref|XP_006406883.1| hypothetical protein EUTSA_v10021833mg [Eutrema salsugineum] gi|557108029|gb|ESQ48336.1| hypothetical protein EUTSA_v10021833mg [Eutrema salsugineum] Length = 95 Score = 65.5 bits (158), Expect = 4e-10 Identities = 28/29 (96%), Positives = 29/29 (100%) Frame = +3 Query: 3 LCVRCGRRSFHLQKSRCSACAYPAARKRT 89 LCVRCGRRSFH+QKSRCSACAYPAARKRT Sbjct: 18 LCVRCGRRSFHIQKSRCSACAYPAARKRT 46 >ref|XP_006392937.1| hypothetical protein EUTSA_v10011894mg [Eutrema salsugineum] gi|923687407|ref|XP_013655520.1| PREDICTED: 60S ribosomal protein L37-2-like [Brassica napus] gi|557089515|gb|ESQ30223.1| hypothetical protein EUTSA_v10011894mg [Eutrema salsugineum] Length = 95 Score = 65.5 bits (158), Expect = 4e-10 Identities = 28/29 (96%), Positives = 29/29 (100%) Frame = +3 Query: 3 LCVRCGRRSFHLQKSRCSACAYPAARKRT 89 LCVRCGRRSFH+QKSRCSACAYPAARKRT Sbjct: 18 LCVRCGRRSFHIQKSRCSACAYPAARKRT 46