BLASTX nr result
ID: Rehmannia27_contig00031680
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia27_contig00031680 (670 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010107989.1| hypothetical protein L484_001316 [Morus nota... 47 9e-07 >ref|XP_010107989.1| hypothetical protein L484_001316 [Morus notabilis] gi|587930350|gb|EXC17474.1| hypothetical protein L484_001316 [Morus notabilis] Length = 335 Score = 47.0 bits (110), Expect(2) = 9e-07 Identities = 21/41 (51%), Positives = 28/41 (68%) Frame = -3 Query: 668 CGMFISDKWQRTSLRNKWNRSKQRWNSTQGRISYTQHRFKK 546 C F DK+Q+ S NK NRS Q++ S G++SY+QHR KK Sbjct: 177 CDRFSGDKFQKISETNKTNRSNQKYPSLHGQVSYSQHRNKK 217 Score = 33.5 bits (75), Expect(2) = 9e-07 Identities = 11/34 (32%), Positives = 21/34 (61%) Frame = -1 Query: 484 NEHAIMREILGQRRGHMTGIGPRLPRRTFAATHP 383 +EH ++ ++LG RRGH + P L ++ ++ P Sbjct: 241 DEHGVLEQVLGMRRGHKIRVDPTLSQKYYSRASP 274