BLASTX nr result
ID: Rehmannia27_contig00030970
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia27_contig00030970 (637 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|NP_054552.1| hypothetical protein NitaCp078 [Nicotiana tabac... 90 3e-20 gb|KMS94058.1| hypothetical protein BVRB_025220 [Beta vulgaris s... 69 9e-13 gb|KDP22997.1| hypothetical protein JCGZ_01719 [Jatropha curcas] 69 4e-10 >ref|NP_054552.1| hypothetical protein NitaCp078 [Nicotiana tabacum] gi|11466023|ref|NP_054565.1| hypothetical protein NitaCp091 [Nicotiana tabacum] gi|78102593|ref|YP_358732.1| hypothetical protein NisyCp089 [Nicotiana sylvestris] gi|78102607|ref|YP_358746.1| hypothetical protein NisyCp103 [Nicotiana sylvestris] gi|81301623|ref|YP_398918.1| hypothetical protein NitoCp088 [Nicotiana tomentosiformis] gi|81301637|ref|YP_398932.1| hypothetical protein NitoCp102 [Nicotiana tomentosiformis] gi|351653935|ref|YP_004891661.1| unnamed protein product (chloroplast) [Nicotiana undulata] gi|351653962|ref|YP_004891675.1| unnamed protein product (chloroplast) [Nicotiana undulata] gi|11786|emb|CAA26288.1| hypothetical protein [Nicotiana tabacum] gi|11880|emb|CAA77393.1| hypothetical protein [Nicotiana tabacum] gi|473681|gb|AAA84690.1| unknown (chloroplast) [Nicotiana tabacum] gi|1223679|emb|CAA77400.1| hypothetical protein [Nicotiana tabacum] gi|77799620|dbj|BAE46709.1| hypothetical protein [Nicotiana sylvestris] gi|77799634|dbj|BAE46723.1| hypothetical protein [Nicotiana sylvestris] gi|80750982|dbj|BAE48058.1| hypothetical protein [Nicotiana tomentosiformis] gi|80750996|dbj|BAE48072.1| hypothetical protein [Nicotiana tomentosiformis] gi|347453961|gb|AEO95619.1| hypothetical protein (chloroplast) [Nicotiana undulata] gi|347453988|gb|AEO95646.1| hypothetical protein (chloroplast) [Nicotiana undulata] gi|347454071|gb|AEO95728.1| hypothetical protein [synthetic construct] gi|347454097|gb|AEO95754.1| hypothetical protein [synthetic construct] gi|1001824243|gb|AMM05595.1| hypothetical protein (plastid) [Nicotiana tabacum] gi|225251|prf||1211235CK ORF 75 Length = 75 Score = 89.7 bits (221), Expect = 3e-20 Identities = 44/51 (86%), Positives = 47/51 (92%) Frame = +1 Query: 7 SYEGGFELILVMG*ERELNSMRSNFPLFLSSSLVERSAINRLVIGSNPTWG 159 SYEG FELILVMG ERELNSMRSN LFLSSS+VERSA+NRLV+GSNPTWG Sbjct: 14 SYEGSFELILVMGWERELNSMRSNLLLFLSSSVVERSAVNRLVVGSNPTWG 64 >gb|KMS94058.1| hypothetical protein BVRB_025220 [Beta vulgaris subsp. vulgaris] Length = 42 Score = 69.3 bits (168), Expect = 9e-13 Identities = 34/42 (80%), Positives = 37/42 (88%) Frame = -3 Query: 137 MTNRLIADRSTSELLRNNGKLDLIEFNSRSQPMTNMSSNPPS 12 MTN+L DRST+ELLRNN +LDLIEFNSRSQPMTNMSS PS Sbjct: 1 MTNQLTTDRSTTELLRNNKRLDLIEFNSRSQPMTNMSSKLPS 42 >gb|KDP22997.1| hypothetical protein JCGZ_01719 [Jatropha curcas] Length = 742 Score = 68.6 bits (166), Expect = 4e-10 Identities = 36/54 (66%), Positives = 41/54 (75%) Frame = -3 Query: 173 FILNFPHVGFEPMTNRLIADRSTSELLRNNGKLDLIEFNSRSQPMTNMSSNPPS 12 F++N P TN+L ADRST+ELLRNNG+ DLIEFNSRSQPMTNMS PS Sbjct: 693 FVVNGP----PKRTNQLTADRSTTELLRNNGRFDLIEFNSRSQPMTNMSLKFPS 742