BLASTX nr result
ID: Rehmannia27_contig00030751
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia27_contig00030751 (469 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AAD50054.1|AC007980_19 Hypothetical protein [Arabidopsis thal... 55 6e-06 >gb|AAD50054.1|AC007980_19 Hypothetical protein [Arabidopsis thaliana] Length = 409 Score = 54.7 bits (130), Expect = 6e-06 Identities = 25/48 (52%), Positives = 34/48 (70%) Frame = +2 Query: 8 KFLAVIRALPDSARDSFDGIYRAVSLYIEVSKFYLYAQ*FFRTLKVLL 151 KFL V +LPDSARD FDG+YRA+ +Y++VS F+L + F+ V L Sbjct: 354 KFLGVAESLPDSARDCFDGVYRAIDIYLQVSFFFLLSYKFYYYFFVFL 401