BLASTX nr result
ID: Rehmannia27_contig00030462
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia27_contig00030462 (951 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_012837449.1| PREDICTED: uncharacterized protein LOC105957... 60 2e-07 ref|XP_011079602.1| PREDICTED: uncharacterized protein LOC105163... 55 7e-06 >ref|XP_012837449.1| PREDICTED: uncharacterized protein LOC105957994 [Erythranthe guttata] gi|604348619|gb|EYU46774.1| hypothetical protein MIMGU_mgv1a015756mg [Erythranthe guttata] Length = 147 Score = 59.7 bits (143), Expect = 2e-07 Identities = 34/51 (66%), Positives = 35/51 (68%), Gaps = 1/51 (1%) Frame = -2 Query: 152 RLNTTGRKRKMRVVQLXXXXXXXXXXR-FWRIKLTPRLKLKLRFSPKKFLL 3 RLN GRKRK R V+L R FWRIKLT RLKLKLRFSPKKFLL Sbjct: 23 RLNAAGRKRKTRTVELASAAEGSTRRRRFWRIKLTRRLKLKLRFSPKKFLL 73 >ref|XP_011079602.1| PREDICTED: uncharacterized protein LOC105163081 [Sesamum indicum] Length = 151 Score = 55.1 bits (131), Expect = 7e-06 Identities = 33/52 (63%), Positives = 34/52 (65%), Gaps = 2/52 (3%) Frame = -2 Query: 152 RLNTTGRKRKMRVVQLXXXXXXXXXXRFWRIKLTPR--LKLKLRFSPKKFLL 3 RLN GRKRK VV+L FWRIKL PR LKLKLRFSPKKFLL Sbjct: 23 RLNGAGRKRKTHVVELAPGGSARRRR-FWRIKLMPRLKLKLKLRFSPKKFLL 73