BLASTX nr result
ID: Rehmannia27_contig00030362
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia27_contig00030362 (594 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_012851959.1| PREDICTED: uncharacterized protein LOC105971... 60 3e-07 >ref|XP_012851959.1| PREDICTED: uncharacterized protein LOC105971648 [Erythranthe guttata] gi|604306148|gb|EYU25205.1| hypothetical protein MIMGU_mgv1a002180mg [Erythranthe guttata] Length = 704 Score = 59.7 bits (143), Expect = 3e-07 Identities = 28/46 (60%), Positives = 36/46 (78%) Frame = -1 Query: 588 NPSTATRTSNSFQQAQDQSKRAYTESHASSGMEGSFKKRKEDDYSN 451 +PS A + +N QQAQD+ KRAY ESH+S+G EGSFK+RK DD S+ Sbjct: 286 DPSVAAKAANVVQQAQDKLKRAYNESHSSAGWEGSFKQRKLDDDSS 331