BLASTX nr result
ID: Rehmannia27_contig00030255
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia27_contig00030255 (529 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_012856427.1| PREDICTED: 1-phosphatidylinositol-3-phosphat... 69 2e-10 ref|XP_012856426.1| PREDICTED: 1-phosphatidylinositol-3-phosphat... 69 2e-10 gb|EYU21277.1| hypothetical protein MIMGU_mgv1a000104mg [Erythra... 69 2e-10 ref|XP_011072684.1| PREDICTED: 1-phosphatidylinositol-3-phosphat... 65 3e-09 gb|EYU45914.1| hypothetical protein MIMGU_mgv1a000120mg [Erythra... 64 8e-09 ref|XP_012832545.1| PREDICTED: 1-phosphatidylinositol-3-phosphat... 64 8e-09 ref|XP_012832491.1| PREDICTED: 1-phosphatidylinositol-3-phosphat... 64 8e-09 ref|XP_013610534.1| PREDICTED: 1-phosphatidylinositol-3-phosphat... 61 7e-08 ref|XP_011015190.1| PREDICTED: 1-phosphatidylinositol-3-phosphat... 61 7e-08 ref|XP_011036542.1| PREDICTED: 1-phosphatidylinositol-3-phosphat... 61 7e-08 ref|XP_011015189.1| PREDICTED: 1-phosphatidylinositol-3-phosphat... 61 7e-08 ref|XP_011036541.1| PREDICTED: 1-phosphatidylinositol-3-phosphat... 61 7e-08 ref|XP_011015187.1| PREDICTED: 1-phosphatidylinositol-3-phosphat... 61 7e-08 ref|XP_011036539.1| PREDICTED: 1-phosphatidylinositol-3-phosphat... 61 7e-08 ref|XP_002303331.2| hypothetical protein POPTR_0003s06990g [Popu... 61 7e-08 emb|CDY60692.1| BnaA01g37040D [Brassica napus] 61 9e-08 ref|XP_009117033.1| PREDICTED: 1-phosphatidylinositol-3-phosphat... 61 9e-08 ref|XP_009117025.1| PREDICTED: 1-phosphatidylinositol-3-phosphat... 61 9e-08 ref|XP_009117010.1| PREDICTED: 1-phosphatidylinositol-3-phosphat... 61 9e-08 ref|XP_013728951.1| PREDICTED: 1-phosphatidylinositol-3-phosphat... 61 9e-08 >ref|XP_012856427.1| PREDICTED: 1-phosphatidylinositol-3-phosphate 5-kinase FAB1B-like isoform X2 [Erythranthe guttata] Length = 1764 Score = 68.6 bits (166), Expect = 2e-10 Identities = 28/37 (75%), Positives = 31/37 (83%) Frame = +2 Query: 419 MGDGDRTVPDRISLLKSWIPWRSEPAHVSRDFWMPDE 529 M D DRT+ D + L KSWIPWRSEPAHVSRDFWMPD+ Sbjct: 1 MDDKDRTLSDLVGLFKSWIPWRSEPAHVSRDFWMPDQ 37 >ref|XP_012856426.1| PREDICTED: 1-phosphatidylinositol-3-phosphate 5-kinase FAB1B-like isoform X1 [Erythranthe guttata] Length = 1770 Score = 68.6 bits (166), Expect = 2e-10 Identities = 28/37 (75%), Positives = 31/37 (83%) Frame = +2 Query: 419 MGDGDRTVPDRISLLKSWIPWRSEPAHVSRDFWMPDE 529 M D DRT+ D + L KSWIPWRSEPAHVSRDFWMPD+ Sbjct: 1 MDDKDRTLSDLVGLFKSWIPWRSEPAHVSRDFWMPDQ 37 >gb|EYU21277.1| hypothetical protein MIMGU_mgv1a000104mg [Erythranthe guttata] Length = 1780 Score = 68.6 bits (166), Expect = 2e-10 Identities = 28/37 (75%), Positives = 31/37 (83%) Frame = +2 Query: 419 MGDGDRTVPDRISLLKSWIPWRSEPAHVSRDFWMPDE 529 M D DRT+ D + L KSWIPWRSEPAHVSRDFWMPD+ Sbjct: 1 MDDKDRTLSDLVGLFKSWIPWRSEPAHVSRDFWMPDQ 37 >ref|XP_011072684.1| PREDICTED: 1-phosphatidylinositol-3-phosphate 5-kinase FAB1B-like [Sesamum indicum] Length = 1818 Score = 65.1 bits (157), Expect = 3e-09 Identities = 27/36 (75%), Positives = 30/36 (83%) Frame = +2 Query: 419 MGDGDRTVPDRISLLKSWIPWRSEPAHVSRDFWMPD 526 M + DRTV D + L+KSWI WRSEPAHVSRDFWMPD Sbjct: 1 MDNSDRTVSDLVGLVKSWISWRSEPAHVSRDFWMPD 36 >gb|EYU45914.1| hypothetical protein MIMGU_mgv1a000120mg [Erythranthe guttata] Length = 1732 Score = 63.9 bits (154), Expect = 8e-09 Identities = 27/37 (72%), Positives = 29/37 (78%) Frame = +2 Query: 419 MGDGDRTVPDRISLLKSWIPWRSEPAHVSRDFWMPDE 529 M +RT D I LLKSWIPWR+EP HVSRDFWMPDE Sbjct: 1 MDSPNRTFSDLIGLLKSWIPWRAEPTHVSRDFWMPDE 37 >ref|XP_012832545.1| PREDICTED: 1-phosphatidylinositol-3-phosphate 5-kinase FAB1B-like isoform X2 [Erythranthe guttata] Length = 1779 Score = 63.9 bits (154), Expect = 8e-09 Identities = 27/37 (72%), Positives = 29/37 (78%) Frame = +2 Query: 419 MGDGDRTVPDRISLLKSWIPWRSEPAHVSRDFWMPDE 529 M +RT D I LLKSWIPWR+EP HVSRDFWMPDE Sbjct: 1 MDSPNRTFSDLIGLLKSWIPWRAEPTHVSRDFWMPDE 37 >ref|XP_012832491.1| PREDICTED: 1-phosphatidylinositol-3-phosphate 5-kinase FAB1B-like isoform X1 [Erythranthe guttata] Length = 1780 Score = 63.9 bits (154), Expect = 8e-09 Identities = 27/37 (72%), Positives = 29/37 (78%) Frame = +2 Query: 419 MGDGDRTVPDRISLLKSWIPWRSEPAHVSRDFWMPDE 529 M +RT D I LLKSWIPWR+EP HVSRDFWMPDE Sbjct: 1 MDSPNRTFSDLIGLLKSWIPWRAEPTHVSRDFWMPDE 37 >ref|XP_013610534.1| PREDICTED: 1-phosphatidylinositol-3-phosphate 5-kinase FAB1B [Brassica oleracea var. oleracea] Length = 1755 Score = 61.2 bits (147), Expect = 7e-08 Identities = 25/36 (69%), Positives = 31/36 (86%) Frame = +2 Query: 422 GDGDRTVPDRISLLKSWIPWRSEPAHVSRDFWMPDE 529 GD +RT+ + + LLKSW+PWRSEPA VSRDFWMPD+ Sbjct: 9 GDCNRTLCEIVGLLKSWLPWRSEPATVSRDFWMPDQ 44 >ref|XP_011015190.1| PREDICTED: 1-phosphatidylinositol-3-phosphate 5-kinase FAB1B-like isoform X3 [Populus euphratica] Length = 1780 Score = 61.2 bits (147), Expect = 7e-08 Identities = 26/37 (70%), Positives = 29/37 (78%) Frame = +2 Query: 419 MGDGDRTVPDRISLLKSWIPWRSEPAHVSRDFWMPDE 529 M D+T + I LLKSWIPWRSEPA VSRDFWMPD+ Sbjct: 1 MESSDKTFSELICLLKSWIPWRSEPASVSRDFWMPDQ 37 >ref|XP_011036542.1| PREDICTED: 1-phosphatidylinositol-3-phosphate 5-kinase FAB1B-like isoform X3 [Populus euphratica] Length = 1780 Score = 61.2 bits (147), Expect = 7e-08 Identities = 26/37 (70%), Positives = 29/37 (78%) Frame = +2 Query: 419 MGDGDRTVPDRISLLKSWIPWRSEPAHVSRDFWMPDE 529 M D+T + I LLKSWIPWRSEPA VSRDFWMPD+ Sbjct: 1 MESSDKTFSELICLLKSWIPWRSEPASVSRDFWMPDQ 37 >ref|XP_011015189.1| PREDICTED: 1-phosphatidylinositol-3-phosphate 5-kinase FAB1B-like isoform X2 [Populus euphratica] Length = 1818 Score = 61.2 bits (147), Expect = 7e-08 Identities = 26/37 (70%), Positives = 29/37 (78%) Frame = +2 Query: 419 MGDGDRTVPDRISLLKSWIPWRSEPAHVSRDFWMPDE 529 M D+T + I LLKSWIPWRSEPA VSRDFWMPD+ Sbjct: 1 MESSDKTFSELICLLKSWIPWRSEPASVSRDFWMPDQ 37 >ref|XP_011036541.1| PREDICTED: 1-phosphatidylinositol-3-phosphate 5-kinase FAB1B-like isoform X2 [Populus euphratica] Length = 1818 Score = 61.2 bits (147), Expect = 7e-08 Identities = 26/37 (70%), Positives = 29/37 (78%) Frame = +2 Query: 419 MGDGDRTVPDRISLLKSWIPWRSEPAHVSRDFWMPDE 529 M D+T + I LLKSWIPWRSEPA VSRDFWMPD+ Sbjct: 1 MESSDKTFSELICLLKSWIPWRSEPASVSRDFWMPDQ 37 >ref|XP_011015187.1| PREDICTED: 1-phosphatidylinositol-3-phosphate 5-kinase FAB1B-like isoform X1 [Populus euphratica] gi|743941400|ref|XP_011015188.1| PREDICTED: 1-phosphatidylinositol-3-phosphate 5-kinase FAB1B-like isoform X1 [Populus euphratica] Length = 1819 Score = 61.2 bits (147), Expect = 7e-08 Identities = 26/37 (70%), Positives = 29/37 (78%) Frame = +2 Query: 419 MGDGDRTVPDRISLLKSWIPWRSEPAHVSRDFWMPDE 529 M D+T + I LLKSWIPWRSEPA VSRDFWMPD+ Sbjct: 1 MESSDKTFSELICLLKSWIPWRSEPASVSRDFWMPDQ 37 >ref|XP_011036539.1| PREDICTED: 1-phosphatidylinositol-3-phosphate 5-kinase FAB1B-like isoform X1 [Populus euphratica] gi|743881693|ref|XP_011036540.1| PREDICTED: 1-phosphatidylinositol-3-phosphate 5-kinase FAB1B-like isoform X1 [Populus euphratica] Length = 1819 Score = 61.2 bits (147), Expect = 7e-08 Identities = 26/37 (70%), Positives = 29/37 (78%) Frame = +2 Query: 419 MGDGDRTVPDRISLLKSWIPWRSEPAHVSRDFWMPDE 529 M D+T + I LLKSWIPWRSEPA VSRDFWMPD+ Sbjct: 1 MESSDKTFSELICLLKSWIPWRSEPASVSRDFWMPDQ 37 >ref|XP_002303331.2| hypothetical protein POPTR_0003s06990g [Populus trichocarpa] gi|550342597|gb|EEE78310.2| hypothetical protein POPTR_0003s06990g [Populus trichocarpa] Length = 1819 Score = 61.2 bits (147), Expect = 7e-08 Identities = 26/37 (70%), Positives = 29/37 (78%) Frame = +2 Query: 419 MGDGDRTVPDRISLLKSWIPWRSEPAHVSRDFWMPDE 529 M D+T + I LLKSWIPWRSEPA VSRDFWMPD+ Sbjct: 1 MESSDKTFSELICLLKSWIPWRSEPASVSRDFWMPDQ 37 >emb|CDY60692.1| BnaA01g37040D [Brassica napus] Length = 1644 Score = 60.8 bits (146), Expect = 9e-08 Identities = 25/36 (69%), Positives = 30/36 (83%) Frame = +2 Query: 422 GDGDRTVPDRISLLKSWIPWRSEPAHVSRDFWMPDE 529 GD RT+ + + LLKSW+PWRSEPA VSRDFWMPD+ Sbjct: 14 GDCSRTLCEIVGLLKSWLPWRSEPATVSRDFWMPDQ 49 >ref|XP_009117033.1| PREDICTED: 1-phosphatidylinositol-3-phosphate 5-kinase FAB1B isoform X3 [Brassica rapa] Length = 1734 Score = 60.8 bits (146), Expect = 9e-08 Identities = 25/36 (69%), Positives = 30/36 (83%) Frame = +2 Query: 422 GDGDRTVPDRISLLKSWIPWRSEPAHVSRDFWMPDE 529 GD RT+ + + LLKSW+PWRSEPA VSRDFWMPD+ Sbjct: 14 GDCSRTLCEIVGLLKSWLPWRSEPATVSRDFWMPDQ 49 >ref|XP_009117025.1| PREDICTED: 1-phosphatidylinositol-3-phosphate 5-kinase FAB1B isoform X2 [Brassica rapa] Length = 1747 Score = 60.8 bits (146), Expect = 9e-08 Identities = 25/36 (69%), Positives = 30/36 (83%) Frame = +2 Query: 422 GDGDRTVPDRISLLKSWIPWRSEPAHVSRDFWMPDE 529 GD RT+ + + LLKSW+PWRSEPA VSRDFWMPD+ Sbjct: 14 GDCSRTLCEIVGLLKSWLPWRSEPATVSRDFWMPDQ 49 >ref|XP_009117010.1| PREDICTED: 1-phosphatidylinositol-3-phosphate 5-kinase FAB1B isoform X1 [Brassica rapa] gi|685265852|ref|XP_009117018.1| PREDICTED: 1-phosphatidylinositol-3-phosphate 5-kinase FAB1B isoform X1 [Brassica rapa] Length = 1771 Score = 60.8 bits (146), Expect = 9e-08 Identities = 25/36 (69%), Positives = 30/36 (83%) Frame = +2 Query: 422 GDGDRTVPDRISLLKSWIPWRSEPAHVSRDFWMPDE 529 GD RT+ + + LLKSW+PWRSEPA VSRDFWMPD+ Sbjct: 14 GDCSRTLCEIVGLLKSWLPWRSEPATVSRDFWMPDQ 49 >ref|XP_013728951.1| PREDICTED: 1-phosphatidylinositol-3-phosphate 5-kinase FAB1B-like [Brassica napus] Length = 1772 Score = 60.8 bits (146), Expect = 9e-08 Identities = 25/36 (69%), Positives = 30/36 (83%) Frame = +2 Query: 422 GDGDRTVPDRISLLKSWIPWRSEPAHVSRDFWMPDE 529 GD RT+ + + LLKSW+PWRSEPA VSRDFWMPD+ Sbjct: 14 GDCSRTLCEIVGLLKSWLPWRSEPATVSRDFWMPDQ 49