BLASTX nr result
ID: Rehmannia27_contig00027903
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia27_contig00027903 (473 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011088583.1| PREDICTED: thaumatin-like protein 1b [Sesamu... 62 2e-08 ref|XP_012837168.1| PREDICTED: thaumatin-like protein 1b [Erythr... 59 2e-07 >ref|XP_011088583.1| PREDICTED: thaumatin-like protein 1b [Sesamum indicum] Length = 292 Score = 61.6 bits (148), Expect = 2e-08 Identities = 28/35 (80%), Positives = 31/35 (88%) Frame = -1 Query: 473 SQKFLATHKDTADLPLVNKTMMYLGRHHTSLSSPG 369 SQKFLA K+TADLPLVNK+MMY+GRHHT LSS G Sbjct: 258 SQKFLAARKETADLPLVNKSMMYIGRHHTRLSSSG 292 >ref|XP_012837168.1| PREDICTED: thaumatin-like protein 1b [Erythranthe guttata] gi|604333584|gb|EYU37935.1| hypothetical protein MIMGU_mgv1a011294mg [Erythranthe guttata] Length = 286 Score = 58.5 bits (140), Expect = 2e-07 Identities = 27/35 (77%), Positives = 30/35 (85%) Frame = -1 Query: 473 SQKFLATHKDTADLPLVNKTMMYLGRHHTSLSSPG 369 SQK L KDTA+LPLVNKTMM++GRHHT LSSPG Sbjct: 252 SQKVLGLLKDTAELPLVNKTMMHMGRHHTRLSSPG 286