BLASTX nr result
ID: Rehmannia27_contig00027667
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia27_contig00027667 (463 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AID23868.1| vanillin synthase [Glechoma hederacea] 58 4e-07 ref|XP_012848129.1| PREDICTED: thiol protease aleurain-like [Ery... 58 4e-07 >gb|AID23868.1| vanillin synthase [Glechoma hederacea] Length = 358 Score = 57.8 bits (138), Expect = 4e-07 Identities = 29/38 (76%), Positives = 32/38 (84%) Frame = -1 Query: 418 MAHVLLLVVGVLIACVADGRARSEFLAEENPIRQVGDG 305 MA +LLL+VGVLIAC A RA SEFLAE+NPIRQV DG Sbjct: 1 MARLLLLLVGVLIACAAGARAGSEFLAEDNPIRQVVDG 38 >ref|XP_012848129.1| PREDICTED: thiol protease aleurain-like [Erythranthe guttata] gi|604315763|gb|EYU28328.1| hypothetical protein MIMGU_mgv1a008911mg [Erythranthe guttata] Length = 358 Score = 57.8 bits (138), Expect = 4e-07 Identities = 29/38 (76%), Positives = 31/38 (81%) Frame = -1 Query: 418 MAHVLLLVVGVLIACVADGRARSEFLAEENPIRQVGDG 305 MA V LL VGVLIAC+A RA SEFLA+ENPIRQV DG Sbjct: 1 MARVALLAVGVLIACIAGARAGSEFLADENPIRQVVDG 38