BLASTX nr result
ID: Rehmannia27_contig00026898
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia27_contig00026898 (518 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002313420.2| hypothetical protein POPTR_0009s09320g [Popu... 71 1e-13 gb|KRH35688.1| hypothetical protein GLYMA_10G258500 [Glycine max] 70 6e-13 ref|XP_010090180.1| 40S ribosomal protein S29 [Morus notabilis] ... 69 1e-12 ref|XP_011078121.1| PREDICTED: 40S ribosomal protein S29 [Sesamu... 68 2e-12 ref|XP_010272246.1| PREDICTED: 40S ribosomal protein S29 [Nelumb... 68 2e-12 ref|XP_010061691.1| PREDICTED: 40S ribosomal protein S29 [Eucaly... 68 2e-12 gb|KGN52774.1| hypothetical protein Csa_4G000930 [Cucumis sativus] 68 2e-12 ref|XP_009393841.1| PREDICTED: 40S ribosomal protein S29 [Musa a... 68 2e-12 gb|ADB02896.1| ribosomal protein S29 [Jatropha curcas] 68 2e-12 ref|XP_002263938.1| PREDICTED: 40S ribosomal protein S29 [Vitis ... 68 2e-12 ref|XP_002271801.1| PREDICTED: 40S ribosomal protein S29-like [V... 68 2e-12 ref|XP_004491390.1| PREDICTED: 40S ribosomal protein S29 [Cicer ... 68 2e-12 gb|KOM36224.1| hypothetical protein LR48_Vigan02g237400 [Vigna a... 69 2e-12 ref|XP_008390572.1| PREDICTED: 40S ribosomal protein S29-like [M... 68 3e-12 ref|XP_007200914.1| hypothetical protein PRUPE_ppb019557mg, part... 68 3e-12 gb|KYP47782.1| 40S ribosomal protein S29 [Cajanus cajan] 68 3e-12 emb|CBI27789.3| unnamed protein product [Vitis vinifera] 68 3e-12 gb|AAT08693.1| ribosomal protein S29 [Hyacinthus orientalis] 68 3e-12 ref|XP_007157215.1| hypothetical protein PHAVU_002G052200g, part... 68 4e-12 ref|XP_010099604.1| 40S ribosomal protein S29 [Morus notabilis] ... 68 4e-12 >ref|XP_002313420.2| hypothetical protein POPTR_0009s09320g [Populus trichocarpa] gi|550331371|gb|EEE87375.2| hypothetical protein POPTR_0009s09320g [Populus trichocarpa] Length = 57 Score = 70.9 bits (172), Expect = 1e-13 Identities = 30/32 (93%), Positives = 31/32 (96%) Frame = -3 Query: 366 NPHGLIRKYGLMCCRQCFRSNAKEIGFIKRHF 271 NPHG+IRKYGLMCCRQCFRSNAKEIGFIKR F Sbjct: 26 NPHGIIRKYGLMCCRQCFRSNAKEIGFIKRSF 57 >gb|KRH35688.1| hypothetical protein GLYMA_10G258500 [Glycine max] Length = 103 Score = 70.5 bits (171), Expect = 6e-13 Identities = 30/35 (85%), Positives = 32/35 (91%) Frame = -3 Query: 366 NPHGLIRKYGLMCCRQCFRSNAKEIGFIKRHFGLV 262 NPHGLIRKYGLMCCRQCFRSNAKEIGFIK H ++ Sbjct: 26 NPHGLIRKYGLMCCRQCFRSNAKEIGFIKVHLNVL 60 >ref|XP_010090180.1| 40S ribosomal protein S29 [Morus notabilis] gi|587848718|gb|EXB38977.1| 40S ribosomal protein S29 [Morus notabilis] Length = 92 Score = 69.3 bits (168), Expect = 1e-12 Identities = 33/48 (68%), Positives = 37/48 (77%) Frame = -3 Query: 366 NPHGLIRKYGLMCCRQCFRSNAKEIGFIKRHFGLVTEKGVDCLE*WTK 223 NPHGLIRKYGLMCCRQCFRSNAKEIGFIK G + C++ W+K Sbjct: 26 NPHGLIRKYGLMCCRQCFRSNAKEIGFIK--IGKAFNAKLPCMD-WSK 70 >ref|XP_011078121.1| PREDICTED: 40S ribosomal protein S29 [Sesamum indicum] gi|747081556|ref|XP_011088056.1| PREDICTED: 40S ribosomal protein S29 [Sesamum indicum] gi|747089732|ref|XP_011092516.1| PREDICTED: 40S ribosomal protein S29 [Sesamum indicum] gi|747092208|ref|XP_011093855.1| PREDICTED: 40S ribosomal protein S29 [Sesamum indicum] Length = 56 Score = 67.8 bits (164), Expect = 2e-12 Identities = 29/29 (100%), Positives = 29/29 (100%) Frame = -3 Query: 366 NPHGLIRKYGLMCCRQCFRSNAKEIGFIK 280 NPHGLIRKYGLMCCRQCFRSNAKEIGFIK Sbjct: 26 NPHGLIRKYGLMCCRQCFRSNAKEIGFIK 54 >ref|XP_010272246.1| PREDICTED: 40S ribosomal protein S29 [Nelumbo nucifera] gi|720018519|ref|XP_010261813.1| PREDICTED: 40S ribosomal protein S29 [Nelumbo nucifera] gi|720068354|ref|XP_010277082.1| PREDICTED: 40S ribosomal protein S29 [Nelumbo nucifera] gi|802550661|ref|XP_012093101.1| PREDICTED: 40S ribosomal protein S29 [Jatropha curcas] Length = 56 Score = 67.8 bits (164), Expect = 2e-12 Identities = 29/29 (100%), Positives = 29/29 (100%) Frame = -3 Query: 366 NPHGLIRKYGLMCCRQCFRSNAKEIGFIK 280 NPHGLIRKYGLMCCRQCFRSNAKEIGFIK Sbjct: 26 NPHGLIRKYGLMCCRQCFRSNAKEIGFIK 54 >ref|XP_010061691.1| PREDICTED: 40S ribosomal protein S29 [Eucalyptus grandis] gi|702462264|ref|XP_010028373.1| PREDICTED: 40S ribosomal protein S29 [Eucalyptus grandis] Length = 56 Score = 67.8 bits (164), Expect = 2e-12 Identities = 29/29 (100%), Positives = 29/29 (100%) Frame = -3 Query: 366 NPHGLIRKYGLMCCRQCFRSNAKEIGFIK 280 NPHGLIRKYGLMCCRQCFRSNAKEIGFIK Sbjct: 26 NPHGLIRKYGLMCCRQCFRSNAKEIGFIK 54 >gb|KGN52774.1| hypothetical protein Csa_4G000930 [Cucumis sativus] Length = 56 Score = 67.8 bits (164), Expect = 2e-12 Identities = 29/29 (100%), Positives = 29/29 (100%) Frame = -3 Query: 366 NPHGLIRKYGLMCCRQCFRSNAKEIGFIK 280 NPHGLIRKYGLMCCRQCFRSNAKEIGFIK Sbjct: 26 NPHGLIRKYGLMCCRQCFRSNAKEIGFIK 54 >ref|XP_009393841.1| PREDICTED: 40S ribosomal protein S29 [Musa acuminata subsp. malaccensis] gi|695034633|ref|XP_009404780.1| PREDICTED: 40S ribosomal protein S29 [Musa acuminata subsp. malaccensis] gi|695065043|ref|XP_009421099.1| PREDICTED: 40S ribosomal protein S29 [Musa acuminata subsp. malaccensis] gi|695078263|ref|XP_009386513.1| PREDICTED: 40S ribosomal protein S29 [Musa acuminata subsp. malaccensis] Length = 56 Score = 67.8 bits (164), Expect = 2e-12 Identities = 29/29 (100%), Positives = 29/29 (100%) Frame = -3 Query: 366 NPHGLIRKYGLMCCRQCFRSNAKEIGFIK 280 NPHGLIRKYGLMCCRQCFRSNAKEIGFIK Sbjct: 26 NPHGLIRKYGLMCCRQCFRSNAKEIGFIK 54 >gb|ADB02896.1| ribosomal protein S29 [Jatropha curcas] Length = 56 Score = 67.8 bits (164), Expect = 2e-12 Identities = 29/29 (100%), Positives = 29/29 (100%) Frame = -3 Query: 366 NPHGLIRKYGLMCCRQCFRSNAKEIGFIK 280 NPHGLIRKYGLMCCRQCFRSNAKEIGFIK Sbjct: 26 NPHGLIRKYGLMCCRQCFRSNAKEIGFIK 54 >ref|XP_002263938.1| PREDICTED: 40S ribosomal protein S29 [Vitis vinifera] gi|470106904|ref|XP_004289795.1| PREDICTED: 40S ribosomal protein S29 [Fragaria vesca subsp. vesca] gi|470109340|ref|XP_004290957.1| PREDICTED: 40S ribosomal protein S29 [Fragaria vesca subsp. vesca] gi|593640056|ref|XP_007143103.1| hypothetical protein PHAVU_007G043800g [Phaseolus vulgaris] gi|561016293|gb|ESW15097.1| hypothetical protein PHAVU_007G043800g [Phaseolus vulgaris] Length = 56 Score = 67.8 bits (164), Expect = 2e-12 Identities = 29/29 (100%), Positives = 29/29 (100%) Frame = -3 Query: 366 NPHGLIRKYGLMCCRQCFRSNAKEIGFIK 280 NPHGLIRKYGLMCCRQCFRSNAKEIGFIK Sbjct: 26 NPHGLIRKYGLMCCRQCFRSNAKEIGFIK 54 >ref|XP_002271801.1| PREDICTED: 40S ribosomal protein S29-like [Vitis vinifera] gi|225444692|ref|XP_002277856.1| PREDICTED: 40S ribosomal protein S29 [Vitis vinifera] gi|255538096|ref|XP_002510113.1| PREDICTED: 40S ribosomal protein S29 [Ricinus communis] gi|356497504|ref|XP_003517600.1| PREDICTED: 40S ribosomal protein S29 [Glycine max] gi|356536119|ref|XP_003536587.1| PREDICTED: 40S ribosomal protein S29 [Glycine max] gi|356538933|ref|XP_003537955.1| PREDICTED: 40S ribosomal protein S29 [Glycine max] gi|356575720|ref|XP_003555985.1| PREDICTED: 40S ribosomal protein S29 [Glycine max] gi|449438331|ref|XP_004136942.1| PREDICTED: 40S ribosomal protein S29 [Cucumis sativus] gi|449447053|ref|XP_004141284.1| PREDICTED: 40S ribosomal protein S29 [Cucumis sativus] gi|449469128|ref|XP_004152273.1| PREDICTED: 40S ribosomal protein S29 [Cucumis sativus] gi|645261744|ref|XP_008236441.1| PREDICTED: 40S ribosomal protein S29 [Prunus mume] gi|657962892|ref|XP_008373047.1| PREDICTED: 40S ribosomal protein S29 [Malus domestica] gi|658061279|ref|XP_008366503.1| PREDICTED: 40S ribosomal protein S29 [Malus domestica] gi|659103501|ref|XP_008452633.1| PREDICTED: 40S ribosomal protein S29 [Cucumis melo] gi|659108782|ref|XP_008454386.1| PREDICTED: 40S ribosomal protein S29 [Cucumis melo] gi|659110059|ref|XP_008455027.1| PREDICTED: 40S ribosomal protein S29 [Cucumis melo] gi|694414331|ref|XP_009335389.1| PREDICTED: 40S ribosomal protein S29 [Pyrus x bretschneideri] gi|694414333|ref|XP_009335391.1| PREDICTED: 40S ribosomal protein S29 [Pyrus x bretschneideri] gi|694414343|ref|XP_009335395.1| PREDICTED: 40S ribosomal protein S29 [Pyrus x bretschneideri] gi|694414345|ref|XP_009335396.1| PREDICTED: 40S ribosomal protein S29 [Pyrus x bretschneideri] gi|802570598|ref|XP_012068241.1| PREDICTED: 40S ribosomal protein S29-like [Jatropha curcas] gi|951021513|ref|XP_014512686.1| PREDICTED: 40S ribosomal protein S29 [Vigna radiata var. radiata] gi|951050510|ref|XP_014520214.1| PREDICTED: 40S ribosomal protein S29 [Vigna radiata var. radiata] gi|1000949638|ref|XP_015579872.1| PREDICTED: 40S ribosomal protein S29 [Ricinus communis] gi|223550814|gb|EEF52300.1| 40S ribosomal protein S29, putative [Ricinus communis] gi|700200099|gb|KGN55257.1| 40S ribosomal protein S29 [Cucumis sativus] gi|734330582|gb|KHN06796.1| 40S ribosomal protein S29 [Glycine soja] gi|734423705|gb|KHN42324.1| 40S ribosomal protein S29 [Glycine soja] Length = 56 Score = 67.8 bits (164), Expect = 2e-12 Identities = 29/29 (100%), Positives = 29/29 (100%) Frame = -3 Query: 366 NPHGLIRKYGLMCCRQCFRSNAKEIGFIK 280 NPHGLIRKYGLMCCRQCFRSNAKEIGFIK Sbjct: 26 NPHGLIRKYGLMCCRQCFRSNAKEIGFIK 54 >ref|XP_004491390.1| PREDICTED: 40S ribosomal protein S29 [Cicer arietinum] gi|502158873|ref|XP_004511309.1| PREDICTED: 40S ribosomal protein S29 [Cicer arietinum] gi|828305776|ref|XP_012570209.1| PREDICTED: 40S ribosomal protein S29 [Cicer arietinum] Length = 56 Score = 67.8 bits (164), Expect = 2e-12 Identities = 29/29 (100%), Positives = 29/29 (100%) Frame = -3 Query: 366 NPHGLIRKYGLMCCRQCFRSNAKEIGFIK 280 NPHGLIRKYGLMCCRQCFRSNAKEIGFIK Sbjct: 26 NPHGLIRKYGLMCCRQCFRSNAKEIGFIK 54 >gb|KOM36224.1| hypothetical protein LR48_Vigan02g237400 [Vigna angularis] Length = 90 Score = 68.6 bits (166), Expect = 2e-12 Identities = 29/30 (96%), Positives = 30/30 (100%) Frame = -3 Query: 366 NPHGLIRKYGLMCCRQCFRSNAKEIGFIKR 277 NPHGLIRKYGLMCCRQCFRSNAKEIGFIK+ Sbjct: 26 NPHGLIRKYGLMCCRQCFRSNAKEIGFIKK 55 >ref|XP_008390572.1| PREDICTED: 40S ribosomal protein S29-like [Malus domestica] Length = 65 Score = 67.8 bits (164), Expect = 3e-12 Identities = 29/29 (100%), Positives = 29/29 (100%) Frame = -3 Query: 366 NPHGLIRKYGLMCCRQCFRSNAKEIGFIK 280 NPHGLIRKYGLMCCRQCFRSNAKEIGFIK Sbjct: 35 NPHGLIRKYGLMCCRQCFRSNAKEIGFIK 63 >ref|XP_007200914.1| hypothetical protein PRUPE_ppb019557mg, partial [Prunus persica] gi|462396314|gb|EMJ02113.1| hypothetical protein PRUPE_ppb019557mg, partial [Prunus persica] Length = 69 Score = 67.8 bits (164), Expect = 3e-12 Identities = 29/29 (100%), Positives = 29/29 (100%) Frame = -3 Query: 366 NPHGLIRKYGLMCCRQCFRSNAKEIGFIK 280 NPHGLIRKYGLMCCRQCFRSNAKEIGFIK Sbjct: 5 NPHGLIRKYGLMCCRQCFRSNAKEIGFIK 33 >gb|KYP47782.1| 40S ribosomal protein S29 [Cajanus cajan] Length = 86 Score = 68.2 bits (165), Expect = 3e-12 Identities = 30/35 (85%), Positives = 31/35 (88%) Frame = -3 Query: 366 NPHGLIRKYGLMCCRQCFRSNAKEIGFIKRHFGLV 262 NPHGLIRKYGLMCCRQCFRSNAKEIGFIK + V Sbjct: 26 NPHGLIRKYGLMCCRQCFRSNAKEIGFIKVNISCV 60 >emb|CBI27789.3| unnamed protein product [Vitis vinifera] Length = 73 Score = 67.8 bits (164), Expect = 3e-12 Identities = 29/29 (100%), Positives = 29/29 (100%) Frame = -3 Query: 366 NPHGLIRKYGLMCCRQCFRSNAKEIGFIK 280 NPHGLIRKYGLMCCRQCFRSNAKEIGFIK Sbjct: 26 NPHGLIRKYGLMCCRQCFRSNAKEIGFIK 54 >gb|AAT08693.1| ribosomal protein S29 [Hyacinthus orientalis] Length = 73 Score = 67.8 bits (164), Expect = 3e-12 Identities = 29/29 (100%), Positives = 29/29 (100%) Frame = -3 Query: 366 NPHGLIRKYGLMCCRQCFRSNAKEIGFIK 280 NPHGLIRKYGLMCCRQCFRSNAKEIGFIK Sbjct: 43 NPHGLIRKYGLMCCRQCFRSNAKEIGFIK 71 >ref|XP_007157215.1| hypothetical protein PHAVU_002G052200g, partial [Phaseolus vulgaris] gi|561030630|gb|ESW29209.1| hypothetical protein PHAVU_002G052200g, partial [Phaseolus vulgaris] Length = 81 Score = 67.8 bits (164), Expect = 4e-12 Identities = 29/29 (100%), Positives = 29/29 (100%) Frame = -3 Query: 366 NPHGLIRKYGLMCCRQCFRSNAKEIGFIK 280 NPHGLIRKYGLMCCRQCFRSNAKEIGFIK Sbjct: 27 NPHGLIRKYGLMCCRQCFRSNAKEIGFIK 55 >ref|XP_010099604.1| 40S ribosomal protein S29 [Morus notabilis] gi|587891408|gb|EXB80035.1| 40S ribosomal protein S29 [Morus notabilis] Length = 82 Score = 67.8 bits (164), Expect = 4e-12 Identities = 29/29 (100%), Positives = 29/29 (100%) Frame = -3 Query: 366 NPHGLIRKYGLMCCRQCFRSNAKEIGFIK 280 NPHGLIRKYGLMCCRQCFRSNAKEIGFIK Sbjct: 52 NPHGLIRKYGLMCCRQCFRSNAKEIGFIK 80