BLASTX nr result
ID: Rehmannia27_contig00026854
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia27_contig00026854 (434 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU21438.1| hypothetical protein MIMGU_mgv1a017424mg [Erythra... 57 4e-08 >gb|EYU21438.1| hypothetical protein MIMGU_mgv1a017424mg [Erythranthe guttata] Length = 76 Score = 56.6 bits (135), Expect = 4e-08 Identities = 27/39 (69%), Positives = 33/39 (84%) Frame = +3 Query: 66 MASKNLRSIMVTLFLLAFVLSPILPTGDAARVTIVQDVL 182 MAS N+ S+MVT+ + FVLSP+L TGDAARVTIVQ+VL Sbjct: 1 MASNNVNSVMVTILVFVFVLSPMLSTGDAARVTIVQEVL 39