BLASTX nr result
ID: Rehmannia27_contig00026760
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia27_contig00026760 (531 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011075843.1| PREDICTED: thaumatin-like protein 1 [Sesamum... 55 8e-06 >ref|XP_011075843.1| PREDICTED: thaumatin-like protein 1 [Sesamum indicum] Length = 297 Score = 54.7 bits (130), Expect = 8e-06 Identities = 27/47 (57%), Positives = 29/47 (61%) Frame = +3 Query: 3 IGGGLQDQAVGESRIRKNEPIVSSSTIQIPFPASIVILFIILYYWHT 143 I GGLQ VGESR K SSSTI +PFP SI +L LY WHT Sbjct: 251 IDGGLQAPEVGESRSGKTAATASSSTILLPFPVSIFVLLFTLYLWHT 297