BLASTX nr result
ID: Rehmannia27_contig00025940
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia27_contig00025940 (689 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_012070738.1| PREDICTED: GDP-mannose transporter GONST1 is... 65 5e-09 ref|XP_012070735.1| PREDICTED: GDP-mannose transporter GONST1 is... 65 5e-09 ref|XP_012854976.1| PREDICTED: GDP-mannose transporter GONST1-li... 65 6e-09 gb|KNA15197.1| hypothetical protein SOVF_100600 [Spinacia oleracea] 65 9e-09 ref|XP_011080450.1| PREDICTED: GDP-mannose transporter GONST1-li... 64 2e-08 gb|KMT09151.1| hypothetical protein BVRB_6g132580 isoform A [Bet... 63 2e-08 ref|XP_010921835.1| PREDICTED: GDP-mannose transporter GONST1-li... 63 2e-08 ref|XP_015891126.1| PREDICTED: GDP-mannose transporter GONST1-li... 61 3e-08 ref|XP_010680203.1| PREDICTED: GDP-mannose transporter GONST1 [B... 63 3e-08 ref|XP_009760360.1| PREDICTED: GDP-mannose transporter GONST1 is... 63 3e-08 gb|KMZ68794.1| GDP-mannose transporter [Zostera marina] 63 3e-08 ref|XP_009760359.1| PREDICTED: GDP-mannose transporter GONST1 is... 63 3e-08 ref|XP_009760358.1| PREDICTED: GDP-mannose transporter GONST1 is... 63 3e-08 ref|XP_011090178.1| PREDICTED: GDP-mannose transporter GONST1-li... 63 4e-08 ref|XP_011090177.1| PREDICTED: GDP-mannose transporter GONST1-li... 63 5e-08 ref|XP_009590643.1| PREDICTED: GDP-mannose transporter GONST1 is... 63 5e-08 emb|CDP09620.1| unnamed protein product [Coffea canephora] 63 5e-08 ref|XP_009590642.1| PREDICTED: GDP-mannose transporter GONST1 is... 63 5e-08 ref|XP_009590641.1| PREDICTED: GDP-mannose transporter GONST1 is... 63 5e-08 ref|XP_008813043.1| PREDICTED: GDP-mannose transporter GONST1-li... 62 5e-08 >ref|XP_012070738.1| PREDICTED: GDP-mannose transporter GONST1 isoform X2 [Jatropha curcas] Length = 336 Score = 65.5 bits (158), Expect = 5e-09 Identities = 28/31 (90%), Positives = 31/31 (100%) Frame = +1 Query: 1 ISGGITDLSFHAIGYTWQFLNCFLTASYSVS 93 ISGGITDLSFHAIGYTWQF+NCFLTASYS++ Sbjct: 168 ISGGITDLSFHAIGYTWQFINCFLTASYSLT 198 >ref|XP_012070735.1| PREDICTED: GDP-mannose transporter GONST1 isoform X1 [Jatropha curcas] gi|802587502|ref|XP_012070736.1| PREDICTED: GDP-mannose transporter GONST1 isoform X1 [Jatropha curcas] gi|802587504|ref|XP_012070737.1| PREDICTED: GDP-mannose transporter GONST1 isoform X1 [Jatropha curcas] gi|643731861|gb|KDP39053.1| hypothetical protein JCGZ_00810 [Jatropha curcas] Length = 378 Score = 65.5 bits (158), Expect = 5e-09 Identities = 28/31 (90%), Positives = 31/31 (100%) Frame = +1 Query: 1 ISGGITDLSFHAIGYTWQFLNCFLTASYSVS 93 ISGGITDLSFHAIGYTWQF+NCFLTASYS++ Sbjct: 210 ISGGITDLSFHAIGYTWQFINCFLTASYSLT 240 >ref|XP_012854976.1| PREDICTED: GDP-mannose transporter GONST1-like [Erythranthe guttata] gi|604348025|gb|EYU46180.1| hypothetical protein MIMGU_mgv1a009672mg [Erythranthe guttata] Length = 335 Score = 65.1 bits (157), Expect = 6e-09 Identities = 27/31 (87%), Positives = 31/31 (100%) Frame = +1 Query: 1 ISGGITDLSFHAIGYTWQFLNCFLTASYSVS 93 ISGGITDLSFHA+GYTWQF+NCFLTASYS++ Sbjct: 170 ISGGITDLSFHAVGYTWQFINCFLTASYSLT 200 >gb|KNA15197.1| hypothetical protein SOVF_100600 [Spinacia oleracea] Length = 346 Score = 64.7 bits (156), Expect = 9e-09 Identities = 26/31 (83%), Positives = 31/31 (100%) Frame = +1 Query: 1 ISGGITDLSFHAIGYTWQFLNCFLTASYSVS 93 ISGG+TDLSFHA+GYTWQF+NCFLTASYS++ Sbjct: 175 ISGGVTDLSFHAVGYTWQFINCFLTASYSLT 205 >ref|XP_011080450.1| PREDICTED: GDP-mannose transporter GONST1-like [Sesamum indicum] Length = 341 Score = 63.9 bits (154), Expect = 2e-08 Identities = 27/31 (87%), Positives = 30/31 (96%) Frame = +1 Query: 1 ISGGITDLSFHAIGYTWQFLNCFLTASYSVS 93 ISGG TDLSFHAIGYTWQF+NCFLTASYS++ Sbjct: 176 ISGGFTDLSFHAIGYTWQFINCFLTASYSLT 206 >gb|KMT09151.1| hypothetical protein BVRB_6g132580 isoform A [Beta vulgaris subsp. vulgaris] Length = 290 Score = 63.2 bits (152), Expect = 2e-08 Identities = 26/31 (83%), Positives = 30/31 (96%) Frame = +1 Query: 1 ISGGITDLSFHAIGYTWQFLNCFLTASYSVS 93 ISGGITDL+FHA+GYTWQF NCFLTASYS++ Sbjct: 119 ISGGITDLTFHAVGYTWQFFNCFLTASYSLT 149 >ref|XP_010921835.1| PREDICTED: GDP-mannose transporter GONST1-like [Elaeis guineensis] Length = 297 Score = 63.2 bits (152), Expect = 2e-08 Identities = 27/30 (90%), Positives = 29/30 (96%) Frame = +1 Query: 1 ISGGITDLSFHAIGYTWQFLNCFLTASYSV 90 ISGGITDLSFHA+GYTWQ +NCFLTASYSV Sbjct: 237 ISGGITDLSFHAVGYTWQIVNCFLTASYSV 266 >ref|XP_015891126.1| PREDICTED: GDP-mannose transporter GONST1-like [Ziziphus jujuba] Length = 175 Score = 61.2 bits (147), Expect = 3e-08 Identities = 26/31 (83%), Positives = 29/31 (93%) Frame = +1 Query: 1 ISGGITDLSFHAIGYTWQFLNCFLTASYSVS 93 ISGGITDLSFHAIGY WQ +NCFLTASYS++ Sbjct: 7 ISGGITDLSFHAIGYAWQIINCFLTASYSLT 37 >ref|XP_010680203.1| PREDICTED: GDP-mannose transporter GONST1 [Beta vulgaris subsp. vulgaris] gi|870857604|gb|KMT09152.1| hypothetical protein BVRB_6g132580 isoform B [Beta vulgaris subsp. vulgaris] Length = 346 Score = 63.2 bits (152), Expect = 3e-08 Identities = 26/31 (83%), Positives = 30/31 (96%) Frame = +1 Query: 1 ISGGITDLSFHAIGYTWQFLNCFLTASYSVS 93 ISGGITDL+FHA+GYTWQF NCFLTASYS++ Sbjct: 175 ISGGITDLTFHAVGYTWQFFNCFLTASYSLT 205 >ref|XP_009760360.1| PREDICTED: GDP-mannose transporter GONST1 isoform X3 [Nicotiana sylvestris] Length = 359 Score = 63.2 bits (152), Expect = 3e-08 Identities = 27/31 (87%), Positives = 30/31 (96%) Frame = +1 Query: 1 ISGGITDLSFHAIGYTWQFLNCFLTASYSVS 93 ISGGITDLSFHAIGYTWQ +NCFLTASYS++ Sbjct: 189 ISGGITDLSFHAIGYTWQIINCFLTASYSLT 219 >gb|KMZ68794.1| GDP-mannose transporter [Zostera marina] Length = 387 Score = 63.2 bits (152), Expect = 3e-08 Identities = 27/31 (87%), Positives = 30/31 (96%) Frame = +1 Query: 1 ISGGITDLSFHAIGYTWQFLNCFLTASYSVS 93 ISGGITDLSFHA+GYTWQ LNCFLTASYS++ Sbjct: 219 ISGGITDLSFHALGYTWQILNCFLTASYSLT 249 >ref|XP_009760359.1| PREDICTED: GDP-mannose transporter GONST1 isoform X2 [Nicotiana sylvestris] Length = 401 Score = 63.2 bits (152), Expect = 3e-08 Identities = 27/31 (87%), Positives = 30/31 (96%) Frame = +1 Query: 1 ISGGITDLSFHAIGYTWQFLNCFLTASYSVS 93 ISGGITDLSFHAIGYTWQ +NCFLTASYS++ Sbjct: 231 ISGGITDLSFHAIGYTWQIINCFLTASYSLT 261 >ref|XP_009760358.1| PREDICTED: GDP-mannose transporter GONST1 isoform X1 [Nicotiana sylvestris] Length = 402 Score = 63.2 bits (152), Expect = 3e-08 Identities = 27/31 (87%), Positives = 30/31 (96%) Frame = +1 Query: 1 ISGGITDLSFHAIGYTWQFLNCFLTASYSVS 93 ISGGITDLSFHAIGYTWQ +NCFLTASYS++ Sbjct: 232 ISGGITDLSFHAIGYTWQIINCFLTASYSLT 262 >ref|XP_011090178.1| PREDICTED: GDP-mannose transporter GONST1-like isoform X2 [Sesamum indicum] Length = 334 Score = 62.8 bits (151), Expect = 4e-08 Identities = 26/31 (83%), Positives = 30/31 (96%) Frame = +1 Query: 1 ISGGITDLSFHAIGYTWQFLNCFLTASYSVS 93 ISGG TDL+FHAIGYTWQF+NCFLTASYS++ Sbjct: 169 ISGGFTDLTFHAIGYTWQFINCFLTASYSLT 199 >ref|XP_011090177.1| PREDICTED: GDP-mannose transporter GONST1-like isoform X1 [Sesamum indicum] Length = 399 Score = 62.8 bits (151), Expect = 5e-08 Identities = 26/31 (83%), Positives = 30/31 (96%) Frame = +1 Query: 1 ISGGITDLSFHAIGYTWQFLNCFLTASYSVS 93 ISGG TDL+FHAIGYTWQF+NCFLTASYS++ Sbjct: 234 ISGGFTDLTFHAIGYTWQFINCFLTASYSLT 264 >ref|XP_009590643.1| PREDICTED: GDP-mannose transporter GONST1 isoform X3 [Nicotiana tomentosiformis] Length = 403 Score = 62.8 bits (151), Expect = 5e-08 Identities = 26/31 (83%), Positives = 30/31 (96%) Frame = +1 Query: 1 ISGGITDLSFHAIGYTWQFLNCFLTASYSVS 93 ISGG+TDLSFHAIGYTWQ +NCFLTASYS++ Sbjct: 231 ISGGVTDLSFHAIGYTWQIINCFLTASYSLT 261 >emb|CDP09620.1| unnamed protein product [Coffea canephora] Length = 414 Score = 62.8 bits (151), Expect = 5e-08 Identities = 26/31 (83%), Positives = 30/31 (96%) Frame = +1 Query: 1 ISGGITDLSFHAIGYTWQFLNCFLTASYSVS 93 ISGGITDLSFHA+GYTWQ +NCFLTASYS++ Sbjct: 246 ISGGITDLSFHAVGYTWQIINCFLTASYSLT 276 >ref|XP_009590642.1| PREDICTED: GDP-mannose transporter GONST1 isoform X2 [Nicotiana tomentosiformis] Length = 473 Score = 62.8 bits (151), Expect = 5e-08 Identities = 26/31 (83%), Positives = 30/31 (96%) Frame = +1 Query: 1 ISGGITDLSFHAIGYTWQFLNCFLTASYSVS 93 ISGG+TDLSFHAIGYTWQ +NCFLTASYS++ Sbjct: 301 ISGGVTDLSFHAIGYTWQIINCFLTASYSLT 331 >ref|XP_009590641.1| PREDICTED: GDP-mannose transporter GONST1 isoform X1 [Nicotiana tomentosiformis] Length = 481 Score = 62.8 bits (151), Expect = 5e-08 Identities = 26/31 (83%), Positives = 30/31 (96%) Frame = +1 Query: 1 ISGGITDLSFHAIGYTWQFLNCFLTASYSVS 93 ISGG+TDLSFHAIGYTWQ +NCFLTASYS++ Sbjct: 309 ISGGVTDLSFHAIGYTWQIINCFLTASYSLT 339 >ref|XP_008813043.1| PREDICTED: GDP-mannose transporter GONST1-like isoform X2 [Phoenix dactylifera] Length = 346 Score = 62.4 bits (150), Expect = 5e-08 Identities = 26/31 (83%), Positives = 30/31 (96%) Frame = +1 Query: 1 ISGGITDLSFHAIGYTWQFLNCFLTASYSVS 93 ISGGITDLSFHA+GYTWQ +NCFLTASYS++ Sbjct: 176 ISGGITDLSFHAVGYTWQIVNCFLTASYSLT 206