BLASTX nr result
ID: Rehmannia27_contig00025913
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia27_contig00025913 (967 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011070913.1| PREDICTED: E3 ubiquitin-protein ligase At3g0... 68 7e-10 >ref|XP_011070913.1| PREDICTED: E3 ubiquitin-protein ligase At3g02290-like [Sesamum indicum] Length = 228 Score = 68.2 bits (165), Expect = 7e-10 Identities = 29/40 (72%), Positives = 33/40 (82%), Gaps = 4/40 (10%) Frame = -2 Query: 108 MGGLCCCFHVLDVQDN----NASSDDCVCPKCFFQKFINQ 1 MG LCCCFHV DVQ+N N+SSDDC+CPKCFFQ FIN+ Sbjct: 1 MGALCCCFHVPDVQNNTGLDNSSSDDCLCPKCFFQNFINK 40