BLASTX nr result
ID: Rehmannia27_contig00025640
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia27_contig00025640 (451 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU20317.1| hypothetical protein MIMGU_mgv1a007928mg [Erythra... 55 4e-06 ref|XP_012857986.1| PREDICTED: ankyrin repeat-containing protein... 55 4e-06 >gb|EYU20317.1| hypothetical protein MIMGU_mgv1a007928mg [Erythranthe guttata] Length = 390 Score = 55.1 bits (131), Expect = 4e-06 Identities = 24/34 (70%), Positives = 27/34 (79%) Frame = +3 Query: 348 ELLKEDPFLLDTVSYTCPNKTPLHVATINGHLAF 449 EL + D FLLD +SYTC NKTPLH+AT GHLAF Sbjct: 24 ELHQTDQFLLDKISYTCSNKTPLHIATTKGHLAF 57 >ref|XP_012857986.1| PREDICTED: ankyrin repeat-containing protein At5g02620-like [Erythranthe guttata] Length = 415 Score = 55.1 bits (131), Expect = 4e-06 Identities = 24/34 (70%), Positives = 27/34 (79%) Frame = +3 Query: 348 ELLKEDPFLLDTVSYTCPNKTPLHVATINGHLAF 449 EL + D FLLD +SYTC NKTPLH+AT GHLAF Sbjct: 29 ELHQTDQFLLDKISYTCSNKTPLHIATTKGHLAF 62