BLASTX nr result
ID: Rehmannia27_contig00024902
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia27_contig00024902 (461 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_012846618.1| PREDICTED: solanesyl diphosphate synthase 3,... 95 3e-20 gb|AEZ55677.1| geranyl diphosphate synthase [Salvia miltiorrhiza... 88 1e-17 ref|XP_011096618.1| PREDICTED: solanesyl diphosphate synthase 3,... 84 4e-16 >ref|XP_012846618.1| PREDICTED: solanesyl diphosphate synthase 3, chloroplastic/mitochondrial isoform X1 [Erythranthe guttata] gi|604317910|gb|EYU29662.1| hypothetical protein MIMGU_mgv1a007049mg [Erythranthe guttata] Length = 421 Score = 95.1 bits (235), Expect = 3e-20 Identities = 46/60 (76%), Positives = 52/60 (86%) Frame = +2 Query: 281 MMSVKGLTRISRSGYARRRWVYSLLGSNNSMPLLEHPTHFRSPVQSSQE*GLGCRVIYSW 460 M SV+GLTR+S+SGYAR RWVYS LGSN+S+PLLEHPTHFRS +Q S E LGCRVIYSW Sbjct: 1 MFSVRGLTRLSKSGYARCRWVYSSLGSNSSVPLLEHPTHFRSHLQPSHE-VLGCRVIYSW 59 >gb|AEZ55677.1| geranyl diphosphate synthase [Salvia miltiorrhiza] gi|448819500|gb|AGE45642.1| solanesyl diphosphate synthase 2 [Salvia miltiorrhiza] Length = 424 Score = 87.8 bits (216), Expect = 1e-17 Identities = 43/61 (70%), Positives = 52/61 (85%), Gaps = 1/61 (1%) Frame = +2 Query: 281 MMSVKGLTRISRSGYARRRWVYSLLGSNNSMPL-LEHPTHFRSPVQSSQE*GLGCRVIYS 457 M+SV+GL R++RSGYARRRWVYS LG + S PL LEH +HFR+P+QSS+E LGCRVIYS Sbjct: 1 MISVRGLARLARSGYARRRWVYSSLGCSGSAPLQLEHSSHFRNPIQSSRE-VLGCRVIYS 59 Query: 458 W 460 W Sbjct: 60 W 60 >ref|XP_011096618.1| PREDICTED: solanesyl diphosphate synthase 3, chloroplastic/mitochondrial isoform X1 [Sesamum indicum] Length = 423 Score = 83.6 bits (205), Expect = 4e-16 Identities = 42/60 (70%), Positives = 49/60 (81%) Frame = +2 Query: 281 MMSVKGLTRISRSGYARRRWVYSLLGSNNSMPLLEHPTHFRSPVQSSQE*GLGCRVIYSW 460 MMSV+GLTR+SRS AR RWVYS LG+ PLL++ +HFRSPVQ+SQE LGCRVIYSW Sbjct: 1 MMSVRGLTRVSRSACARCRWVYSSLGTYADPPLLQNSSHFRSPVQASQE-VLGCRVIYSW 59