BLASTX nr result
ID: Rehmannia27_contig00024702
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia27_contig00024702 (378 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011072290.1| PREDICTED: thaumatin-like protein [Sesamum i... 97 1e-35 ref|XP_012836300.1| PREDICTED: thaumatin-like protein [Erythrant... 97 2e-35 ref|XP_010314485.1| PREDICTED: pathogenesis-related protein R ma... 87 8e-32 ref|XP_012836299.1| PREDICTED: thaumatin-like protein [Erythrant... 90 2e-31 sp|E3SU11.1|ALL13_OLEEU RecName: Full=Thaumatin-like protein; Al... 84 2e-31 gb|AGC39180.1| thaumatin-like protein [Actinidia deliciosa] 87 2e-31 ref|XP_006364119.1| PREDICTED: pathogenesis-related protein R ma... 86 2e-31 ref|XP_015059945.1| PREDICTED: pathogenesis-related protein R ma... 87 4e-31 gb|AGC39181.1| thaumatin-like protein [Actinidia chinensis] 84 7e-31 gb|AGC39182.1| thaumatin-like protein [Actinidia eriantha] 84 2e-30 ref|XP_009627978.1| PREDICTED: pathogenesis-related protein R ma... 84 2e-30 ref|XP_009781670.1| PREDICTED: pathogenesis-related protein R mi... 84 8e-30 sp|P07052.1|PRR2_TOBAC RecName: Full=Pathogenesis-related protei... 84 6e-29 gb|AAU95246.1| putative thaumatin-like protein [Solanum tuberosum] 82 1e-28 ref|XP_006364121.2| PREDICTED: pathogenesis-related protein R ma... 82 2e-28 ref|XP_010053305.1| PREDICTED: protein NP24-like [Eucalyptus gra... 82 3e-28 gb|KCW77573.1| hypothetical protein EUGRSUZ_D01887 [Eucalyptus g... 82 3e-28 ref|XP_002509749.1| PREDICTED: thaumatin-like protein 1 [Ricinus... 80 3e-28 emb|CDP16242.1| unnamed protein product [Coffea canephora] 74 8e-28 ref|XP_002509748.1| PREDICTED: thaumatin-like protein 1 [Ricinus... 78 1e-27 >ref|XP_011072290.1| PREDICTED: thaumatin-like protein [Sesamum indicum] Length = 226 Score = 97.4 bits (241), Expect(3) = 1e-35 Identities = 43/47 (91%), Positives = 47/47 (100%) Frame = +2 Query: 2 PNNLDFVDISLVDGFNIPMEFSPTTNVCRNLRCTAPINDQCPSQLRA 142 PNNLDFVDISLVDGFNIPMEFSPTT+VCRNLRCTAPIN+QCP++LRA Sbjct: 113 PNNLDFVDISLVDGFNIPMEFSPTTDVCRNLRCTAPINEQCPNELRA 159 Score = 77.0 bits (188), Expect(3) = 1e-35 Identities = 32/32 (100%), Positives = 32/32 (100%) Frame = +3 Query: 204 ERCPDAYSYPQDDPTSLFTCPAGTNYRVVFCP 299 ERCPDAYSYPQDDPTSLFTCPAGTNYRVVFCP Sbjct: 195 ERCPDAYSYPQDDPTSLFTCPAGTNYRVVFCP 226 Score = 22.7 bits (47), Expect(3) = 1e-35 Identities = 7/7 (100%), Positives = 7/7 (100%) Frame = +1 Query: 142 PGGCNNP 162 PGGCNNP Sbjct: 160 PGGCNNP 166 >ref|XP_012836300.1| PREDICTED: thaumatin-like protein [Erythranthe guttata] gi|604334283|gb|EYU38380.1| hypothetical protein MIMGU_mgv1a013157mg [Erythranthe guttata] Length = 229 Score = 97.1 bits (240), Expect(3) = 2e-35 Identities = 43/46 (93%), Positives = 45/46 (97%) Frame = +2 Query: 2 PNNLDFVDISLVDGFNIPMEFSPTTNVCRNLRCTAPINDQCPSQLR 139 PNNLDFVDISLVDGFNIPMEFSP TNVCRNLRCTAPINDQCP++LR Sbjct: 116 PNNLDFVDISLVDGFNIPMEFSPITNVCRNLRCTAPINDQCPNELR 161 Score = 77.0 bits (188), Expect(3) = 2e-35 Identities = 32/32 (100%), Positives = 32/32 (100%) Frame = +3 Query: 204 ERCPDAYSYPQDDPTSLFTCPAGTNYRVVFCP 299 ERCPDAYSYPQDDPTSLFTCPAGTNYRVVFCP Sbjct: 198 ERCPDAYSYPQDDPTSLFTCPAGTNYRVVFCP 229 Score = 22.7 bits (47), Expect(3) = 2e-35 Identities = 7/7 (100%), Positives = 7/7 (100%) Frame = +1 Query: 142 PGGCNNP 162 PGGCNNP Sbjct: 163 PGGCNNP 169 >ref|XP_010314485.1| PREDICTED: pathogenesis-related protein R major form [Solanum lycopersicum] Length = 227 Score = 87.0 bits (214), Expect(3) = 8e-32 Identities = 39/47 (82%), Positives = 41/47 (87%) Frame = +2 Query: 2 PNNLDFVDISLVDGFNIPMEFSPTTNVCRNLRCTAPINDQCPSQLRA 142 PNNLDFVDISLVDGFNIPMEFSP CRNL C APINDQCP++LRA Sbjct: 114 PNNLDFVDISLVDGFNIPMEFSPINGGCRNLLCNAPINDQCPNELRA 160 Score = 74.7 bits (182), Expect(3) = 8e-32 Identities = 30/32 (93%), Positives = 32/32 (100%) Frame = +3 Query: 204 ERCPDAYSYPQDDPTSLFTCPAGTNYRVVFCP 299 +RCPDAYSYPQDDPTSLFTCPAGTNY+VVFCP Sbjct: 196 QRCPDAYSYPQDDPTSLFTCPAGTNYKVVFCP 227 Score = 22.7 bits (47), Expect(3) = 8e-32 Identities = 7/7 (100%), Positives = 7/7 (100%) Frame = +1 Query: 142 PGGCNNP 162 PGGCNNP Sbjct: 161 PGGCNNP 167 >ref|XP_012836299.1| PREDICTED: thaumatin-like protein [Erythranthe guttata] gi|604334282|gb|EYU38379.1| hypothetical protein MIMGU_mgv1a013131mg [Erythranthe guttata] Length = 230 Score = 89.7 bits (221), Expect(3) = 2e-31 Identities = 38/46 (82%), Positives = 45/46 (97%) Frame = +2 Query: 5 NNLDFVDISLVDGFNIPMEFSPTTNVCRNLRCTAPINDQCPSQLRA 142 NNLDF+DISLVDGFNIPMEFSPT+N CR++RCTAPIN+QCP++LRA Sbjct: 118 NNLDFLDISLVDGFNIPMEFSPTSNACRSMRCTAPINEQCPNELRA 163 Score = 70.9 bits (172), Expect(3) = 2e-31 Identities = 28/32 (87%), Positives = 30/32 (93%) Frame = +3 Query: 204 ERCPDAYSYPQDDPTSLFTCPAGTNYRVVFCP 299 +RCPDAYSYPQDDP+S FTCP GTNYRVVFCP Sbjct: 199 DRCPDAYSYPQDDPSSTFTCPGGTNYRVVFCP 230 Score = 22.7 bits (47), Expect(3) = 2e-31 Identities = 7/7 (100%), Positives = 7/7 (100%) Frame = +1 Query: 142 PGGCNNP 162 PGGCNNP Sbjct: 164 PGGCNNP 170 >sp|E3SU11.1|ALL13_OLEEU RecName: Full=Thaumatin-like protein; AltName: Allergen=Ole e 13; Flags: Precursor gi|269996497|gb|ACZ57583.1| allergenic thaumatin [Olea europaea] Length = 226 Score = 83.6 bits (205), Expect(3) = 2e-31 Identities = 38/46 (82%), Positives = 40/46 (86%) Frame = +2 Query: 2 PNNLDFVDISLVDGFNIPMEFSPTTNVCRNLRCTAPINDQCPSQLR 139 PNNLDFVDIS VDGFNIP+EFSPTTNVCR L C API QCPS+LR Sbjct: 113 PNNLDFVDISNVDGFNIPLEFSPTTNVCRRLVCNAPIVQQCPSELR 158 Score = 77.0 bits (188), Expect(3) = 2e-31 Identities = 32/32 (100%), Positives = 32/32 (100%) Frame = +3 Query: 204 ERCPDAYSYPQDDPTSLFTCPAGTNYRVVFCP 299 ERCPDAYSYPQDDPTSLFTCPAGTNYRVVFCP Sbjct: 195 ERCPDAYSYPQDDPTSLFTCPAGTNYRVVFCP 226 Score = 22.7 bits (47), Expect(3) = 2e-31 Identities = 7/7 (100%), Positives = 7/7 (100%) Frame = +1 Query: 142 PGGCNNP 162 PGGCNNP Sbjct: 160 PGGCNNP 166 >gb|AGC39180.1| thaumatin-like protein [Actinidia deliciosa] Length = 228 Score = 87.0 bits (214), Expect(3) = 2e-31 Identities = 37/47 (78%), Positives = 43/47 (91%) Frame = +2 Query: 2 PNNLDFVDISLVDGFNIPMEFSPTTNVCRNLRCTAPINDQCPSQLRA 142 P NLDFVDISLVDGFNIPM+FSPTT VC+ LRC APIN++CP++LRA Sbjct: 115 PTNLDFVDISLVDGFNIPMDFSPTTGVCKQLRCAAPINEECPTELRA 161 Score = 73.2 bits (178), Expect(3) = 2e-31 Identities = 29/32 (90%), Positives = 31/32 (96%) Frame = +3 Query: 204 ERCPDAYSYPQDDPTSLFTCPAGTNYRVVFCP 299 +RCPDAYSYPQDDPTSLFTCP GTNY+VVFCP Sbjct: 197 DRCPDAYSYPQDDPTSLFTCPGGTNYKVVFCP 228 Score = 22.7 bits (47), Expect(3) = 2e-31 Identities = 7/7 (100%), Positives = 7/7 (100%) Frame = +1 Query: 142 PGGCNNP 162 PGGCNNP Sbjct: 162 PGGCNNP 168 >ref|XP_006364119.1| PREDICTED: pathogenesis-related protein R major form [Solanum tuberosum] gi|53830843|gb|AAU95244.1| putative thaumatin-like protein [Solanum tuberosum] Length = 227 Score = 85.5 bits (210), Expect(3) = 2e-31 Identities = 38/46 (82%), Positives = 40/46 (86%) Frame = +2 Query: 2 PNNLDFVDISLVDGFNIPMEFSPTTNVCRNLRCTAPINDQCPSQLR 139 PNNLDFVDISLVDGFNIPMEFSP CRNL C APINDQCP++LR Sbjct: 114 PNNLDFVDISLVDGFNIPMEFSPINGGCRNLLCNAPINDQCPNELR 159 Score = 74.7 bits (182), Expect(3) = 2e-31 Identities = 30/32 (93%), Positives = 32/32 (100%) Frame = +3 Query: 204 ERCPDAYSYPQDDPTSLFTCPAGTNYRVVFCP 299 +RCPDAYSYPQDDPTSLFTCPAGTNY+VVFCP Sbjct: 196 QRCPDAYSYPQDDPTSLFTCPAGTNYKVVFCP 227 Score = 22.7 bits (47), Expect(3) = 2e-31 Identities = 7/7 (100%), Positives = 7/7 (100%) Frame = +1 Query: 142 PGGCNNP 162 PGGCNNP Sbjct: 161 PGGCNNP 167 >ref|XP_015059945.1| PREDICTED: pathogenesis-related protein R major form [Solanum pennellii] Length = 227 Score = 87.0 bits (214), Expect(3) = 4e-31 Identities = 39/47 (82%), Positives = 41/47 (87%) Frame = +2 Query: 2 PNNLDFVDISLVDGFNIPMEFSPTTNVCRNLRCTAPINDQCPSQLRA 142 PNNLDFVDISLVDGFNIPMEFSP CRNL C APINDQCP++LRA Sbjct: 114 PNNLDFVDISLVDGFNIPMEFSPINGGCRNLLCNAPINDQCPNELRA 160 Score = 74.7 bits (182), Expect(3) = 4e-31 Identities = 30/32 (93%), Positives = 32/32 (100%) Frame = +3 Query: 204 ERCPDAYSYPQDDPTSLFTCPAGTNYRVVFCP 299 +RCPDAYSYPQDDPTSLFTCPAGTNY+VVFCP Sbjct: 196 QRCPDAYSYPQDDPTSLFTCPAGTNYKVVFCP 227 Score = 20.4 bits (41), Expect(3) = 4e-31 Identities = 6/7 (85%), Positives = 6/7 (85%) Frame = +1 Query: 142 PGGCNNP 162 P GCNNP Sbjct: 161 PSGCNNP 167 >gb|AGC39181.1| thaumatin-like protein [Actinidia chinensis] Length = 228 Score = 84.3 bits (207), Expect(3) = 7e-31 Identities = 36/47 (76%), Positives = 43/47 (91%) Frame = +2 Query: 2 PNNLDFVDISLVDGFNIPMEFSPTTNVCRNLRCTAPINDQCPSQLRA 142 P NLDFVDISLVDGFNIPM+FSPTT VC++LRC A IN++CP++LRA Sbjct: 115 PTNLDFVDISLVDGFNIPMDFSPTTGVCKSLRCAAAINEECPTELRA 161 Score = 74.3 bits (181), Expect(3) = 7e-31 Identities = 30/32 (93%), Positives = 31/32 (96%) Frame = +3 Query: 204 ERCPDAYSYPQDDPTSLFTCPAGTNYRVVFCP 299 +RCPDAYSYPQDDPTSLFTCP GTNYRVVFCP Sbjct: 197 DRCPDAYSYPQDDPTSLFTCPGGTNYRVVFCP 228 Score = 22.7 bits (47), Expect(3) = 7e-31 Identities = 7/7 (100%), Positives = 7/7 (100%) Frame = +1 Query: 142 PGGCNNP 162 PGGCNNP Sbjct: 162 PGGCNNP 168 >gb|AGC39182.1| thaumatin-like protein [Actinidia eriantha] Length = 228 Score = 84.0 bits (206), Expect(3) = 2e-30 Identities = 36/47 (76%), Positives = 42/47 (89%) Frame = +2 Query: 2 PNNLDFVDISLVDGFNIPMEFSPTTNVCRNLRCTAPINDQCPSQLRA 142 P NLDFVDISLVDGFNIPM+FSPTT VC+ LRC A IN++CP++LRA Sbjct: 115 PTNLDFVDISLVDGFNIPMDFSPTTGVCKQLRCAAAINEECPAELRA 161 Score = 73.2 bits (178), Expect(3) = 2e-30 Identities = 29/32 (90%), Positives = 31/32 (96%) Frame = +3 Query: 204 ERCPDAYSYPQDDPTSLFTCPAGTNYRVVFCP 299 +RCPDAYSYPQDDPTSLFTCP GTNY+VVFCP Sbjct: 197 DRCPDAYSYPQDDPTSLFTCPGGTNYKVVFCP 228 Score = 22.7 bits (47), Expect(3) = 2e-30 Identities = 7/7 (100%), Positives = 7/7 (100%) Frame = +1 Query: 142 PGGCNNP 162 PGGCNNP Sbjct: 162 PGGCNNP 168 >ref|XP_009627978.1| PREDICTED: pathogenesis-related protein R major form [Nicotiana tomentosiformis] gi|131015|sp|P13046.1|PRR1_TOBAC RecName: Full=Pathogenesis-related protein R major form; AltName: Full=Thaumatin-like protein E22; Flags: Precursor gi|19855|emb|CAA33293.1| thaumatin-like protein [Nicotiana tabacum] gi|19980|emb|CAA31235.1| unnamed protein product [Nicotiana tabacum] gi|58200453|gb|AAW66482.1| thaumatin-like protein [Nicotiana tabacum] Length = 226 Score = 83.6 bits (205), Expect(2) = 2e-30 Identities = 37/44 (84%), Positives = 40/44 (90%) Frame = +2 Query: 8 NLDFVDISLVDGFNIPMEFSPTTNVCRNLRCTAPINDQCPSQLR 139 N DFVDISLVDGFNIPMEFSPT CRNLRCTAPIN+QCP+QL+ Sbjct: 115 NQDFVDISLVDGFNIPMEFSPTNGGCRNLRCTAPINEQCPAQLK 158 Score = 75.9 bits (185), Expect(2) = 2e-30 Identities = 31/32 (96%), Positives = 32/32 (100%) Frame = +3 Query: 204 ERCPDAYSYPQDDPTSLFTCPAGTNYRVVFCP 299 ERCPDAYSYPQDDPTSLFTCP+GTNYRVVFCP Sbjct: 195 ERCPDAYSYPQDDPTSLFTCPSGTNYRVVFCP 226 >ref|XP_009781670.1| PREDICTED: pathogenesis-related protein R minor form [Nicotiana sylvestris] Length = 226 Score = 83.6 bits (205), Expect(2) = 8e-30 Identities = 37/44 (84%), Positives = 40/44 (90%) Frame = +2 Query: 8 NLDFVDISLVDGFNIPMEFSPTTNVCRNLRCTAPINDQCPSQLR 139 N DFVDISLVDGFNIPMEFSPT CRNLRCTAPIN+QCP+QL+ Sbjct: 115 NQDFVDISLVDGFNIPMEFSPTNGGCRNLRCTAPINEQCPAQLK 158 Score = 73.9 bits (180), Expect(2) = 8e-30 Identities = 30/31 (96%), Positives = 31/31 (100%) Frame = +3 Query: 207 RCPDAYSYPQDDPTSLFTCPAGTNYRVVFCP 299 RCPDAYSYPQDDPTSLFTCP+GTNYRVVFCP Sbjct: 196 RCPDAYSYPQDDPTSLFTCPSGTNYRVVFCP 226 >sp|P07052.1|PRR2_TOBAC RecName: Full=Pathogenesis-related protein R minor form; Short=PR-R; AltName: Full=PROB12; AltName: Full=Thaumatin-like protein E2; Flags: Precursor [Nicotiana tabacum] gi|19857|emb|CAA33292.1| thaumatin-like protein [Nicotiana tabacum] gi|20043|emb|CAA27548.1| unnamed protein product [Nicotiana tabacum] gi|225022|prf||1206322A protein,TMV induced Length = 226 Score = 83.6 bits (205), Expect(2) = 6e-29 Identities = 37/44 (84%), Positives = 40/44 (90%) Frame = +2 Query: 8 NLDFVDISLVDGFNIPMEFSPTTNVCRNLRCTAPINDQCPSQLR 139 N DFVDISLVDGFNIPMEFSPT CRNLRCTAPIN+QCP+QL+ Sbjct: 115 NQDFVDISLVDGFNIPMEFSPTNGGCRNLRCTAPINEQCPAQLK 158 Score = 70.9 bits (172), Expect(2) = 6e-29 Identities = 29/31 (93%), Positives = 29/31 (93%) Frame = +3 Query: 207 RCPDAYSYPQDDPTSLFTCPAGTNYRVVFCP 299 RCPDAYSYPQDDP SLFTCP GTNYRVVFCP Sbjct: 196 RCPDAYSYPQDDPPSLFTCPPGTNYRVVFCP 226 >gb|AAU95246.1| putative thaumatin-like protein [Solanum tuberosum] Length = 246 Score = 82.4 bits (202), Expect(3) = 1e-28 Identities = 37/47 (78%), Positives = 40/47 (85%) Frame = +2 Query: 2 PNNLDFVDISLVDGFNIPMEFSPTTNVCRNLRCTAPINDQCPSQLRA 142 PNNLDFVDISLVDGFNIPMEFSP CR +RC+A IN QCPS+LRA Sbjct: 110 PNNLDFVDISLVDGFNIPMEFSPINGGCRKIRCSADINGQCPSELRA 156 Score = 68.6 bits (166), Expect(3) = 1e-28 Identities = 28/36 (77%), Positives = 31/36 (86%) Frame = +3 Query: 204 ERCPDAYSYPQDDPTSLFTCPAGTNYRVVFCP*TNF 311 +RCPDAYSYP DDPTS+FTC AGTNY+VVFCP F Sbjct: 192 QRCPDAYSYPLDDPTSMFTCHAGTNYKVVFCPGNTF 227 Score = 22.7 bits (47), Expect(3) = 1e-28 Identities = 7/7 (100%), Positives = 7/7 (100%) Frame = +1 Query: 142 PGGCNNP 162 PGGCNNP Sbjct: 157 PGGCNNP 163 >ref|XP_006364121.2| PREDICTED: pathogenesis-related protein R major form-like [Solanum tuberosum] Length = 426 Score = 82.4 bits (202), Expect(3) = 2e-28 Identities = 37/47 (78%), Positives = 40/47 (85%) Frame = +2 Query: 2 PNNLDFVDISLVDGFNIPMEFSPTTNVCRNLRCTAPINDQCPSQLRA 142 PNNLDFVDISLVDGFNIPMEFSP CR +RC+A IN QCPS+LRA Sbjct: 110 PNNLDFVDISLVDGFNIPMEFSPINGGCRKIRCSADINGQCPSELRA 156 Score = 67.8 bits (164), Expect(3) = 2e-28 Identities = 27/32 (84%), Positives = 30/32 (93%) Frame = +3 Query: 204 ERCPDAYSYPQDDPTSLFTCPAGTNYRVVFCP 299 +RCPDAYSYP DDPTS+FTC AGTNY+VVFCP Sbjct: 192 QRCPDAYSYPLDDPTSMFTCHAGTNYKVVFCP 223 Score = 22.7 bits (47), Expect(3) = 2e-28 Identities = 7/7 (100%), Positives = 7/7 (100%) Frame = +1 Query: 142 PGGCNNP 162 PGGCNNP Sbjct: 157 PGGCNNP 163 Score = 56.2 bits (134), Expect(3) = 3e-15 Identities = 29/47 (61%), Positives = 35/47 (74%), Gaps = 2/47 (4%) Frame = +2 Query: 5 NNLDFVDISLVDGFNIPMEFSP-TTNVCR-NLRCTAPINDQCPSQLR 139 NN DF+ ISLVDGFNIPMEFSP + + C + CTA I QCP++LR Sbjct: 314 NNNDFLGISLVDGFNIPMEFSPVSADECSVRITCTADIIGQCPNELR 360 Score = 48.9 bits (115), Expect(3) = 3e-15 Identities = 19/32 (59%), Positives = 24/32 (75%) Frame = +3 Query: 204 ERCPDAYSYPQDDPTSLFTCPAGTNYRVVFCP 299 ++C +YSY D TS F CP+GT+YRVVFCP Sbjct: 395 DKCSTSYSYSLDSSTSAFFCPSGTSYRVVFCP 426 Score = 22.7 bits (47), Expect(3) = 3e-15 Identities = 7/7 (100%), Positives = 7/7 (100%) Frame = +1 Query: 142 PGGCNNP 162 PGGCNNP Sbjct: 362 PGGCNNP 368 >ref|XP_010053305.1| PREDICTED: protein NP24-like [Eucalyptus grandis] Length = 425 Score = 81.6 bits (200), Expect(3) = 3e-28 Identities = 34/47 (72%), Positives = 41/47 (87%) Frame = +2 Query: 2 PNNLDFVDISLVDGFNIPMEFSPTTNVCRNLRCTAPINDQCPSQLRA 142 PNN+DF+DISLVDGFNIPM+FSPTT CR +RC A IN QCP++L+A Sbjct: 312 PNNVDFLDISLVDGFNIPMDFSPTTGACRGIRCAADINGQCPAELKA 358 Score = 68.2 bits (165), Expect(3) = 3e-28 Identities = 26/31 (83%), Positives = 29/31 (93%) Frame = +3 Query: 207 RCPDAYSYPQDDPTSLFTCPAGTNYRVVFCP 299 +CPDAYSYPQDDPTS FTCP+GTNY+V FCP Sbjct: 395 KCPDAYSYPQDDPTSTFTCPSGTNYKVTFCP 425 Score = 22.7 bits (47), Expect(3) = 3e-28 Identities = 7/7 (100%), Positives = 7/7 (100%) Frame = +1 Query: 142 PGGCNNP 162 PGGCNNP Sbjct: 359 PGGCNNP 365 Score = 68.9 bits (167), Expect(3) = 6e-21 Identities = 32/49 (65%), Positives = 38/49 (77%), Gaps = 4/49 (8%) Frame = +2 Query: 8 NLDFVDISLVDGFNIPMEFSPT----TNVCRNLRCTAPINDQCPSQLRA 142 NLDF DISLVDGFNIPMEFSPT CR ++CT+ +N QCP+QL+A Sbjct: 110 NLDFYDISLVDGFNIPMEFSPTRPSSKAKCRQIKCTSDVNGQCPNQLKA 158 Score = 55.8 bits (133), Expect(3) = 6e-21 Identities = 24/30 (80%), Positives = 27/30 (90%), Gaps = 1/30 (3%) Frame = +3 Query: 207 RCPDAYSYPQDDPTSLFTCPAG-TNYRVVF 293 +CPDAYSYPQDDPTS FTCP+G T+Y VVF Sbjct: 193 KCPDAYSYPQDDPTSTFTCPSGSTDYTVVF 222 Score = 22.7 bits (47), Expect(3) = 6e-21 Identities = 7/7 (100%), Positives = 7/7 (100%) Frame = +1 Query: 142 PGGCNNP 162 PGGCNNP Sbjct: 159 PGGCNNP 165 >gb|KCW77573.1| hypothetical protein EUGRSUZ_D01887 [Eucalyptus grandis] Length = 227 Score = 81.6 bits (200), Expect(3) = 3e-28 Identities = 34/47 (72%), Positives = 41/47 (87%) Frame = +2 Query: 2 PNNLDFVDISLVDGFNIPMEFSPTTNVCRNLRCTAPINDQCPSQLRA 142 PNN+DF+DISLVDGFNIPM+FSPTT CR +RC A IN QCP++L+A Sbjct: 114 PNNVDFLDISLVDGFNIPMDFSPTTGACRGIRCAADINGQCPAELKA 160 Score = 68.2 bits (165), Expect(3) = 3e-28 Identities = 26/31 (83%), Positives = 29/31 (93%) Frame = +3 Query: 207 RCPDAYSYPQDDPTSLFTCPAGTNYRVVFCP 299 +CPDAYSYPQDDPTS FTCP+GTNY+V FCP Sbjct: 197 KCPDAYSYPQDDPTSTFTCPSGTNYKVTFCP 227 Score = 22.7 bits (47), Expect(3) = 3e-28 Identities = 7/7 (100%), Positives = 7/7 (100%) Frame = +1 Query: 142 PGGCNNP 162 PGGCNNP Sbjct: 161 PGGCNNP 167 >ref|XP_002509749.1| PREDICTED: thaumatin-like protein 1 [Ricinus communis] gi|223549648|gb|EEF51136.1| Osmotin precursor, putative [Ricinus communis] Length = 225 Score = 79.7 bits (195), Expect(3) = 3e-28 Identities = 34/46 (73%), Positives = 39/46 (84%) Frame = +2 Query: 5 NNLDFVDISLVDGFNIPMEFSPTTNVCRNLRCTAPINDQCPSQLRA 142 NN DF+DISLVDGFNIPM+FSPTT CR +RC A IN QCP+QL+A Sbjct: 113 NNRDFIDISLVDGFNIPMDFSPTTGACRGIRCAADINGQCPAQLKA 158 Score = 70.1 bits (170), Expect(3) = 3e-28 Identities = 28/31 (90%), Positives = 28/31 (90%) Frame = +3 Query: 207 RCPDAYSYPQDDPTSLFTCPAGTNYRVVFCP 299 RCPDAYSYPQDDPTS FTCP GTNYRV FCP Sbjct: 195 RCPDAYSYPQDDPTSTFTCPGGTNYRVTFCP 225 Score = 22.7 bits (47), Expect(3) = 3e-28 Identities = 7/7 (100%), Positives = 7/7 (100%) Frame = +1 Query: 142 PGGCNNP 162 PGGCNNP Sbjct: 159 PGGCNNP 165 >emb|CDP16242.1| unnamed protein product [Coffea canephora] Length = 224 Score = 74.3 bits (181), Expect(3) = 8e-28 Identities = 33/46 (71%), Positives = 40/46 (86%) Frame = +2 Query: 2 PNNLDFVDISLVDGFNIPMEFSPTTNVCRNLRCTAPINDQCPSQLR 139 PNN+D++DIS VDGFNIPMEFS T CRN+RC+API DQCP++LR Sbjct: 112 PNNVDYIDISNVDGFNIPMEFSSVTR-CRNIRCSAPIVDQCPAKLR 156 Score = 73.9 bits (180), Expect(3) = 8e-28 Identities = 30/31 (96%), Positives = 31/31 (100%) Frame = +3 Query: 207 RCPDAYSYPQDDPTSLFTCPAGTNYRVVFCP 299 RCPDAYSYPQDDPTSLFTCP+GTNYRVVFCP Sbjct: 194 RCPDAYSYPQDDPTSLFTCPSGTNYRVVFCP 224 Score = 22.7 bits (47), Expect(3) = 8e-28 Identities = 7/7 (100%), Positives = 7/7 (100%) Frame = +1 Query: 142 PGGCNNP 162 PGGCNNP Sbjct: 158 PGGCNNP 164 >ref|XP_002509748.1| PREDICTED: thaumatin-like protein 1 [Ricinus communis] gi|223549647|gb|EEF51135.1| Osmotin precursor, putative [Ricinus communis] Length = 225 Score = 78.2 bits (191), Expect(3) = 1e-27 Identities = 33/46 (71%), Positives = 39/46 (84%) Frame = +2 Query: 5 NNLDFVDISLVDGFNIPMEFSPTTNVCRNLRCTAPINDQCPSQLRA 142 NN DF+DISLVDGFNIPM+FSPTT CR +RC A IN QCP++L+A Sbjct: 113 NNNDFIDISLVDGFNIPMDFSPTTGACRGIRCAADINGQCPAELKA 158 Score = 69.7 bits (169), Expect(3) = 1e-27 Identities = 27/32 (84%), Positives = 30/32 (93%) Frame = +3 Query: 204 ERCPDAYSYPQDDPTSLFTCPAGTNYRVVFCP 299 +RCPDAYSYPQDDP+S FTCP+GTNYRV FCP Sbjct: 194 DRCPDAYSYPQDDPSSTFTCPSGTNYRVTFCP 225 Score = 22.7 bits (47), Expect(3) = 1e-27 Identities = 7/7 (100%), Positives = 7/7 (100%) Frame = +1 Query: 142 PGGCNNP 162 PGGCNNP Sbjct: 159 PGGCNNP 165