BLASTX nr result
ID: Rehmannia27_contig00024618
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia27_contig00024618 (454 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_012852090.1| PREDICTED: ATP-dependent zinc metalloproteas... 60 6e-08 >ref|XP_012852090.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 11, chloroplastic/mitochondrial [Erythranthe guttata] gi|604306145|gb|EYU25202.1| hypothetical protein MIMGU_mgv1a001611mg [Erythranthe guttata] Length = 785 Score = 60.5 bits (145), Expect = 6e-08 Identities = 28/51 (54%), Positives = 39/51 (76%) Frame = +1 Query: 301 MAVTLQASLIYRPLIPQLNPLSLSLKPRFPNSSPHLSLSRRINGKLSNSIS 453 M +TLQASL++RPLIPQLNP SLS+KP +S +S+ RRI ++S+ +S Sbjct: 1 MTITLQASLLHRPLIPQLNPFSLSVKPLLSSSHRQISVHRRIKDRISDPVS 51