BLASTX nr result
ID: Rehmannia27_contig00022926
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia27_contig00022926 (530 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011070676.1| PREDICTED: ALG-2 interacting protein X-like ... 66 2e-09 ref|XP_011075927.1| PREDICTED: ALG-2 interacting protein X-like ... 65 3e-09 ref|XP_009758027.1| PREDICTED: ALG-2 interacting protein X-like ... 63 1e-08 ref|XP_012846094.1| PREDICTED: ALG-2 interacting protein X [Eryt... 62 5e-08 ref|XP_002283981.1| PREDICTED: ALG-2 interacting protein X [Viti... 60 2e-07 emb|CDP00719.1| unnamed protein product [Coffea canephora] 60 2e-07 ref|XP_009596592.1| PREDICTED: proline-rich protein 2-like isofo... 57 9e-07 dbj|BAD15108.1| ALG2-interacting protein X [Nicotiana tabacum] 57 2e-06 ref|XP_011015064.1| PREDICTED: programmed cell death 6-interacti... 55 5e-06 ref|XP_011038763.1| PREDICTED: programmed cell death 6-interacti... 55 6e-06 ref|XP_002315900.1| hydroxyproline-rich glycoprotein [Populus tr... 55 8e-06 >ref|XP_011070676.1| PREDICTED: ALG-2 interacting protein X-like [Sesamum indicum] Length = 871 Score = 65.9 bits (159), Expect = 2e-09 Identities = 32/46 (69%), Positives = 38/46 (82%), Gaps = 1/46 (2%) Frame = +2 Query: 2 ISGLSFQDGKSSAS-YSFPSTGQPHQTQRANSLQQQDPGNMPNTSH 136 ISGLSFQDGKS+ S +SFPS G P+ +QR+NS QQ D GNMPN+SH Sbjct: 727 ISGLSFQDGKSTTSGHSFPSAGPPYHSQRSNSQQQLDVGNMPNSSH 772 >ref|XP_011075927.1| PREDICTED: ALG-2 interacting protein X-like [Sesamum indicum] Length = 869 Score = 65.1 bits (157), Expect = 3e-09 Identities = 31/45 (68%), Positives = 36/45 (80%) Frame = +2 Query: 2 ISGLSFQDGKSSASYSFPSTGQPHQTQRANSLQQQDPGNMPNTSH 136 I+GLSFQDGK++A YS+PSTG H TQR+NS Q DPGN NTSH Sbjct: 727 IAGLSFQDGKTTAGYSYPSTGHAHLTQRSNS--QPDPGNTSNTSH 769 >ref|XP_009758027.1| PREDICTED: ALG-2 interacting protein X-like [Nicotiana sylvestris] Length = 876 Score = 63.2 bits (152), Expect = 1e-08 Identities = 29/44 (65%), Positives = 32/44 (72%) Frame = +2 Query: 2 ISGLSFQDGKSSASYSFPSTGQPHQTQRANSLQQQDPGNMPNTS 133 ISGLSFQDGKSS Y++PS GQPHQ RAN D GN+PN S Sbjct: 728 ISGLSFQDGKSSGGYAYPSVGQPHQAPRANPQLPTDTGNIPNPS 771 >ref|XP_012846094.1| PREDICTED: ALG-2 interacting protein X [Erythranthe guttata] gi|604318544|gb|EYU30036.1| hypothetical protein MIMGU_mgv1a001174mg [Erythranthe guttata] Length = 873 Score = 61.6 bits (148), Expect = 5e-08 Identities = 31/47 (65%), Positives = 37/47 (78%), Gaps = 2/47 (4%) Frame = +2 Query: 2 ISGLSFQDGKSSASYSF-PSTGQPHQTQRANS-LQQQDPGNMPNTSH 136 I+GLSFQ+GKS+A YS+ P+ PHQ QR NS QQQDP NMPN+SH Sbjct: 727 IAGLSFQEGKSNAGYSYTPAGPPPHQVQRTNSQQQQQDPSNMPNSSH 773 >ref|XP_002283981.1| PREDICTED: ALG-2 interacting protein X [Vitis vinifera] Length = 873 Score = 60.1 bits (144), Expect = 2e-07 Identities = 26/44 (59%), Positives = 35/44 (79%) Frame = +2 Query: 2 ISGLSFQDGKSSASYSFPSTGQPHQTQRANSLQQQDPGNMPNTS 133 ++GLSFQDGK++ +Y++PS QPHQTQRA S QQ +P NM + S Sbjct: 725 MAGLSFQDGKNTGAYNYPSVSQPHQTQRATSQQQTEPVNMTHPS 768 >emb|CDP00719.1| unnamed protein product [Coffea canephora] Length = 877 Score = 59.7 bits (143), Expect = 2e-07 Identities = 26/45 (57%), Positives = 33/45 (73%) Frame = +2 Query: 2 ISGLSFQDGKSSASYSFPSTGQPHQTQRANSLQQQDPGNMPNTSH 136 I+GLSFQD KS+ YS+P+ GQPHQT R NS Q +P ++ N SH Sbjct: 731 IAGLSFQDNKSTGGYSYPAAGQPHQTPRPNSQQHTEPVHVSNPSH 775 >ref|XP_009596592.1| PREDICTED: proline-rich protein 2-like isoform X1 [Nicotiana tomentosiformis] gi|697175306|ref|XP_009596593.1| PREDICTED: proline-rich protein 2-like isoform X2 [Nicotiana tomentosiformis] Length = 242 Score = 57.0 bits (136), Expect = 9e-07 Identities = 26/42 (61%), Positives = 30/42 (71%) Frame = +2 Query: 2 ISGLSFQDGKSSASYSFPSTGQPHQTQRANSLQQQDPGNMPN 127 ISGLSFQD KSS+ Y++PS GQP Q RAN D GN+PN Sbjct: 94 ISGLSFQDSKSSSGYAYPSVGQPQQAPRANPQLPPDTGNIPN 135 >dbj|BAD15108.1| ALG2-interacting protein X [Nicotiana tabacum] Length = 876 Score = 57.0 bits (136), Expect = 2e-06 Identities = 26/42 (61%), Positives = 30/42 (71%) Frame = +2 Query: 2 ISGLSFQDGKSSASYSFPSTGQPHQTQRANSLQQQDPGNMPN 127 ISGLSFQD KSS+ Y++PS GQP Q RAN D GN+PN Sbjct: 728 ISGLSFQDSKSSSGYAYPSVGQPQQAPRANPQLPADTGNIPN 769 >ref|XP_011015064.1| PREDICTED: programmed cell death 6-interacting protein-like [Populus euphratica] Length = 278 Score = 55.1 bits (131), Expect = 5e-06 Identities = 23/42 (54%), Positives = 33/42 (78%) Frame = +2 Query: 2 ISGLSFQDGKSSASYSFPSTGQPHQTQRANSLQQQDPGNMPN 127 ++GLSFQD K++ SYS+P+ QPHQTQR++S DP N+P+ Sbjct: 132 MAGLSFQDHKNAGSYSYPAVNQPHQTQRSSSHPPSDPQNVPH 173 >ref|XP_011038763.1| PREDICTED: programmed cell death 6-interacting protein-like [Populus euphratica] Length = 318 Score = 55.1 bits (131), Expect = 6e-06 Identities = 23/42 (54%), Positives = 33/42 (78%) Frame = +2 Query: 2 ISGLSFQDGKSSASYSFPSTGQPHQTQRANSLQQQDPGNMPN 127 ++GLSFQD K++ SYS+P+ QPHQTQR++S DP N+P+ Sbjct: 172 MAGLSFQDHKNAGSYSYPAVNQPHQTQRSSSHPPSDPQNVPH 213 >ref|XP_002315900.1| hydroxyproline-rich glycoprotein [Populus trichocarpa] gi|222864940|gb|EEF02071.1| hydroxyproline-rich glycoprotein [Populus trichocarpa] Length = 861 Score = 55.1 bits (131), Expect = 8e-06 Identities = 23/42 (54%), Positives = 33/42 (78%) Frame = +2 Query: 2 ISGLSFQDGKSSASYSFPSTGQPHQTQRANSLQQQDPGNMPN 127 ++GLSFQD K++ SYS+P+ QPHQTQR++S DP N+P+ Sbjct: 713 MAGLSFQDHKNTGSYSYPAANQPHQTQRSSSHPPSDPQNVPH 754