BLASTX nr result
ID: Rehmannia27_contig00022710
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia27_contig00022710 (525 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KYP40770.1| Retrovirus-related Pol polyprotein from transposo... 53 3e-06 gb|KYP40767.1| Retrovirus-related Pol polyprotein from transposo... 53 4e-06 >gb|KYP40770.1| Retrovirus-related Pol polyprotein from transposon TNT 1-94 [Cajanus cajan] Length = 86 Score = 52.8 bits (125), Expect = 3e-06 Identities = 28/66 (42%), Positives = 41/66 (62%) Frame = +2 Query: 287 LGVPSRDENETW*LVTLPFGKKQLDAKCSPLNTKLIDGTVDKFNVQLVAKWFTKVNIVEY 466 L + + ++N TW LVTLP GKK + K DGT++++ V+LVAK FT+ V+Y Sbjct: 3 LEMEALEKNNTWKLVTLPPGKKPVGCKWVYTVKYRADGTIERYKVRLVAKGFTQTYGVDY 62 Query: 467 EESLAP 484 E+ AP Sbjct: 63 LETFAP 68 >gb|KYP40767.1| Retrovirus-related Pol polyprotein from transposon TNT 1-94, partial [Cajanus cajan] Length = 109 Score = 52.8 bits (125), Expect = 4e-06 Identities = 28/66 (42%), Positives = 41/66 (62%) Frame = +2 Query: 287 LGVPSRDENETW*LVTLPFGKKQLDAKCSPLNTKLIDGTVDKFNVQLVAKWFTKVNIVEY 466 L + + ++N TW LVTLP GKK + K DGT++++ V+LVAK FT+ V+Y Sbjct: 26 LEMEALEKNNTWKLVTLPPGKKPVGCKWVYTVKYRADGTIERYKVRLVAKGFTQTYGVDY 85 Query: 467 EESLAP 484 E+ AP Sbjct: 86 LETFAP 91