BLASTX nr result
ID: Rehmannia27_contig00021319
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia27_contig00021319 (474 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011069582.1| PREDICTED: pentatricopeptide repeat-containi... 85 3e-16 ref|XP_012837859.1| PREDICTED: pentatricopeptide repeat-containi... 77 1e-13 >ref|XP_011069582.1| PREDICTED: pentatricopeptide repeat-containing protein At4g30825, chloroplastic [Sesamum indicum] Length = 937 Score = 84.7 bits (208), Expect = 3e-16 Identities = 45/61 (73%), Positives = 49/61 (80%) Frame = +2 Query: 290 MASLKLSVSPDNNSYESNKLISGFNSLKFVSNTLFSGYVSTHGALIVKPFCKLKHIRVSR 469 MASLKLSVS DN+ YES K NSLKF S+TLFSGYV T+GALIVKPFCKLK IRV+ Sbjct: 1 MASLKLSVSVDNSCYESKKQRFALNSLKFGSSTLFSGYVITNGALIVKPFCKLKQIRVNG 60 Query: 470 L 472 L Sbjct: 61 L 61 >ref|XP_012837859.1| PREDICTED: pentatricopeptide repeat-containing protein At4g30825, chloroplastic [Erythranthe guttata] gi|604332485|gb|EYU37145.1| hypothetical protein MIMGU_mgv1a000931mg [Erythranthe guttata] Length = 939 Score = 77.0 bits (188), Expect = 1e-13 Identities = 43/63 (68%), Positives = 49/63 (77%), Gaps = 2/63 (3%) Frame = +2 Query: 290 MASLKLSVSPDNNSY-ESNKLISGFNSLKFVSNTLFSGYVSTHG-ALIVKPFCKLKHIRV 463 MASLKLSV P+ NS+ ES KL S KF S+ LFSGY ST+G ALIVKPFC+LKHIRV Sbjct: 1 MASLKLSVYPEQNSFHESKKLTSAVIPFKFASSVLFSGYFSTNGGALIVKPFCELKHIRV 60 Query: 464 SRL 472 S+L Sbjct: 61 SKL 63