BLASTX nr result
ID: Rehmannia27_contig00021020
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia27_contig00021020 (362 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011073037.1| PREDICTED: retrovirus-related Pol polyprotei... 62 6e-09 ref|XP_011100917.1| PREDICTED: uncharacterized protein LOC105179... 57 1e-07 >ref|XP_011073037.1| PREDICTED: retrovirus-related Pol polyprotein from transposon TNT 1-94 [Sesamum indicum] Length = 472 Score = 62.0 bits (149), Expect = 6e-09 Identities = 26/32 (81%), Positives = 32/32 (100%) Frame = +3 Query: 267 LSGYNLEPFNGKTDFSIWQQKMKGILIQQKVY 362 ++GY+L+PF+GKTDFSIWQQKMKGILIQQKV+ Sbjct: 1 MAGYSLQPFDGKTDFSIWQQKMKGILIQQKVF 32 >ref|XP_011100917.1| PREDICTED: uncharacterized protein LOC105179028 [Sesamum indicum] Length = 188 Score = 57.0 bits (136), Expect = 1e-07 Identities = 24/32 (75%), Positives = 30/32 (93%) Frame = +3 Query: 267 LSGYNLEPFNGKTDFSIWQQKMKGILIQQKVY 362 + GY+L+ F+GK+DFSIWQQKMKGILIQQKV+ Sbjct: 1 MDGYSLQSFDGKSDFSIWQQKMKGILIQQKVF 32