BLASTX nr result
ID: Rehmannia27_contig00018806
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia27_contig00018806 (633 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011076647.1| PREDICTED: dehydration-responsive element-bi... 69 2e-10 >ref|XP_011076647.1| PREDICTED: dehydration-responsive element-binding protein 2A-like [Sesamum indicum] Length = 375 Score = 69.3 bits (168), Expect = 2e-10 Identities = 40/98 (40%), Positives = 55/98 (56%), Gaps = 9/98 (9%) Frame = -1 Query: 630 QSAKAGDNLFANFTQEEMFDMEQLLEEMDSDRHHVSGPQDMGGLCGSQPEQVANDGAVYP 451 +SA A + F NF +EMFD+++LL +D+ SG Q G G P + A + Sbjct: 261 RSAMAPLHQFNNFPLDEMFDVDELLAALDAAPRQASGHQVGPGAYGGHPSEAACGSGSFA 320 Query: 450 DMSSQLQ---------DQTLSIYDYGLDFLRPGRQEDY 364 DMS++ Q +QT S Y+ GLDFL+PGRQEDY Sbjct: 321 DMSARWQHSGSELFGSEQTTSGYENGLDFLKPGRQEDY 358