BLASTX nr result
ID: Rehmannia27_contig00018448
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia27_contig00018448 (451 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011082812.1| PREDICTED: mitogen-activated protein kinase ... 60 5e-08 ref|XP_011082811.1| PREDICTED: mitogen-activated protein kinase ... 60 5e-08 ref|XP_012836509.1| PREDICTED: mitogen-activated protein kinase ... 56 2e-06 >ref|XP_011082812.1| PREDICTED: mitogen-activated protein kinase 19 isoform X2 [Sesamum indicum] Length = 622 Score = 60.5 bits (145), Expect = 5e-08 Identities = 36/50 (72%), Positives = 41/50 (82%), Gaps = 3/50 (6%) Frame = +1 Query: 1 YYQSQSKAAGIMNSQIAIDAKLLQAQSQFVVSGPAAAAH---GTVQLGLT 141 YYQS +KA G++NSQIAIDAKLLQAQSQFV +G AAAH G +QLGLT Sbjct: 576 YYQSPAKA-GMLNSQIAIDAKLLQAQSQFVAAG--AAAHREVGAIQLGLT 622 >ref|XP_011082811.1| PREDICTED: mitogen-activated protein kinase 19 isoform X1 [Sesamum indicum] Length = 625 Score = 60.5 bits (145), Expect = 5e-08 Identities = 36/50 (72%), Positives = 41/50 (82%), Gaps = 3/50 (6%) Frame = +1 Query: 1 YYQSQSKAAGIMNSQIAIDAKLLQAQSQFVVSGPAAAAH---GTVQLGLT 141 YYQS +KA G++NSQIAIDAKLLQAQSQFV +G AAAH G +QLGLT Sbjct: 579 YYQSPAKA-GMLNSQIAIDAKLLQAQSQFVAAG--AAAHREVGAIQLGLT 625 >ref|XP_012836509.1| PREDICTED: mitogen-activated protein kinase 15-like [Erythranthe guttata] gi|604334036|gb|EYU38234.1| hypothetical protein MIMGU_mgv1a002799mg [Erythranthe guttata] Length = 636 Score = 56.2 bits (134), Expect = 2e-06 Identities = 31/51 (60%), Positives = 37/51 (72%), Gaps = 4/51 (7%) Frame = +1 Query: 1 YYQSQSKAAGIMNSQIAIDAKLLQAQSQFVVSGPAAAAH----GTVQLGLT 141 YYQSQ+K+ GIMN+QIAID KL Q QSQFV +GP A G VQ+GL+ Sbjct: 587 YYQSQAKS-GIMNNQIAIDGKLFQIQSQFVAAGPTAVTSHREVGVVQVGLS 636