BLASTX nr result
ID: Rehmannia27_contig00018409
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia27_contig00018409 (350 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011088804.1| PREDICTED: cyclin-dependent kinases regulato... 81 7e-18 ref|XP_010031422.1| PREDICTED: cyclin-dependent kinases regulato... 81 7e-18 ref|XP_012064672.1| PREDICTED: cyclin-dependent kinases regulato... 81 7e-18 ref|NP_180363.1| cyclin-dependent kinases regulatory subunit 1 [... 80 1e-17 ref|XP_006295329.1| hypothetical protein CARUB_v10024417mg [Caps... 80 2e-17 ref|XP_002879125.1| cdk-subunit 1 [Arabidopsis lyrata subsp. lyr... 80 2e-17 gb|KCW50716.1| hypothetical protein EUGRSUZ_J00392, partial [Euc... 81 2e-17 ref|XP_011009277.1| PREDICTED: cyclin-dependent kinases regulato... 79 2e-17 gb|ABK94640.1| unknown [Populus trichocarpa] 79 2e-17 ref|XP_002523737.1| PREDICTED: cyclin-dependent kinases regulato... 79 3e-17 ref|XP_006424430.1| hypothetical protein CICLE_v10029696mg [Citr... 79 3e-17 ref|XP_012444712.1| PREDICTED: cyclin-dependent kinases regulato... 79 4e-17 ref|XP_010267302.1| PREDICTED: cyclin-dependent kinases regulato... 79 5e-17 ref|XP_010417949.1| PREDICTED: cyclin-dependent kinases regulato... 78 8e-17 ref|XP_010510708.1| PREDICTED: cyclin-dependent kinases regulato... 78 8e-17 ref|XP_010542578.1| PREDICTED: cyclin-dependent kinases regulato... 78 1e-16 gb|KHG01535.1| Cyclin-dependent kinases regulatory subunit 1 [Go... 78 1e-16 ref|XP_012475898.1| PREDICTED: cyclin-dependent kinases regulato... 78 1e-16 ref|XP_010241657.1| PREDICTED: cyclin-dependent kinases regulato... 78 1e-16 ref|XP_009592163.1| PREDICTED: cyclin-dependent kinases regulato... 78 1e-16 >ref|XP_011088804.1| PREDICTED: cyclin-dependent kinases regulatory subunit 1 [Sesamum indicum] Length = 88 Score = 80.9 bits (198), Expect = 7e-18 Identities = 38/43 (88%), Positives = 39/43 (90%), Gaps = 4/43 (9%) Frame = -1 Query: 350 VQQSRGWVHYAVHRPEPHIMLFRRPLNYQQQQE----QNMLAK 234 VQQSRGWVHYA+HRPEPHIMLFRRPLNYQQQQE QNMLAK Sbjct: 46 VQQSRGWVHYAIHRPEPHIMLFRRPLNYQQQQENQAQQNMLAK 88 >ref|XP_010031422.1| PREDICTED: cyclin-dependent kinases regulatory subunit 1 [Eucalyptus grandis] gi|702473811|ref|XP_010031423.1| PREDICTED: cyclin-dependent kinases regulatory subunit 1 [Eucalyptus grandis] Length = 88 Score = 80.9 bits (198), Expect = 7e-18 Identities = 38/43 (88%), Positives = 39/43 (90%), Gaps = 4/43 (9%) Frame = -1 Query: 350 VQQSRGWVHYAVHRPEPHIMLFRRPLNYQQQQE----QNMLAK 234 VQQSRGWVHYA+HRPEPHIMLFRRPLNYQQQQE QNMLAK Sbjct: 46 VQQSRGWVHYAIHRPEPHIMLFRRPLNYQQQQENQAQQNMLAK 88 >ref|XP_012064672.1| PREDICTED: cyclin-dependent kinases regulatory subunit 1 [Jatropha curcas] gi|643737964|gb|KDP43952.1| hypothetical protein JCGZ_05419 [Jatropha curcas] Length = 88 Score = 80.9 bits (198), Expect = 7e-18 Identities = 38/43 (88%), Positives = 39/43 (90%), Gaps = 4/43 (9%) Frame = -1 Query: 350 VQQSRGWVHYAVHRPEPHIMLFRRPLNYQQQQE----QNMLAK 234 VQQSRGWVHYA+HRPEPHIMLFRRPLNYQQQQE QNMLAK Sbjct: 46 VQQSRGWVHYAIHRPEPHIMLFRRPLNYQQQQENQAQQNMLAK 88 >ref|NP_180363.1| cyclin-dependent kinases regulatory subunit 1 [Arabidopsis thaliana] gi|75097781|sp|O23249.1|CKS1_ARATH RecName: Full=Cyclin-dependent kinases regulatory subunit 1; AltName: Full=CKS1-At gi|2274859|emb|CAA03859.1| Cks1 protein [Arabidopsis thaliana] gi|4510420|gb|AAD21506.1| putative cyclin-dependent kinase regulatory subunit [Arabidopsis thaliana] gi|21593913|gb|AAM65878.1| putative cyclin-dependent kinase regulatory subunit [Arabidopsis thaliana] gi|51969580|dbj|BAD43482.1| putative cyclin-dependent kinase regulatory subunit [Arabidopsis thaliana] gi|51969798|dbj|BAD43591.1| putative cyclin-dependent kinase regulatory subunit [Arabidopsis thaliana] gi|51970380|dbj|BAD43882.1| putative cyclin-dependent kinase regulatory subunit [Arabidopsis thaliana] gi|88010880|gb|ABD38867.1| At2g27960 [Arabidopsis thaliana] gi|330252970|gb|AEC08064.1| cyclin-dependent kinases regulatory subunit 1 [Arabidopsis thaliana] Length = 87 Score = 80.1 bits (196), Expect = 1e-17 Identities = 38/42 (90%), Positives = 38/42 (90%), Gaps = 3/42 (7%) Frame = -1 Query: 350 VQQSRGWVHYAVHRPEPHIMLFRRPLNYQQQQE---QNMLAK 234 VQQSRGWVHYAVHRPEPHIMLFRRPLNYQQQQE QNML K Sbjct: 46 VQQSRGWVHYAVHRPEPHIMLFRRPLNYQQQQENQAQNMLVK 87 >ref|XP_006295329.1| hypothetical protein CARUB_v10024417mg [Capsella rubella] gi|482564037|gb|EOA28227.1| hypothetical protein CARUB_v10024417mg [Capsella rubella] Length = 87 Score = 79.7 bits (195), Expect = 2e-17 Identities = 37/42 (88%), Positives = 38/42 (90%), Gaps = 3/42 (7%) Frame = -1 Query: 350 VQQSRGWVHYAVHRPEPHIMLFRRPLNYQQQQE---QNMLAK 234 VQQSRGWVHYA+HRPEPHIMLFRRPLNYQQQQE QNML K Sbjct: 46 VQQSRGWVHYAIHRPEPHIMLFRRPLNYQQQQENQAQNMLVK 87 >ref|XP_002879125.1| cdk-subunit 1 [Arabidopsis lyrata subsp. lyrata] gi|297324964|gb|EFH55384.1| cdk-subunit 1 [Arabidopsis lyrata subsp. lyrata] Length = 87 Score = 79.7 bits (195), Expect = 2e-17 Identities = 37/42 (88%), Positives = 38/42 (90%), Gaps = 3/42 (7%) Frame = -1 Query: 350 VQQSRGWVHYAVHRPEPHIMLFRRPLNYQQQQE---QNMLAK 234 VQQSRGWVHYA+HRPEPHIMLFRRPLNYQQQQE QNML K Sbjct: 46 VQQSRGWVHYAIHRPEPHIMLFRRPLNYQQQQENQAQNMLVK 87 >gb|KCW50716.1| hypothetical protein EUGRSUZ_J00392, partial [Eucalyptus grandis] Length = 132 Score = 80.9 bits (198), Expect = 2e-17 Identities = 38/43 (88%), Positives = 39/43 (90%), Gaps = 4/43 (9%) Frame = -1 Query: 350 VQQSRGWVHYAVHRPEPHIMLFRRPLNYQQQQE----QNMLAK 234 VQQSRGWVHYA+HRPEPHIMLFRRPLNYQQQQE QNMLAK Sbjct: 90 VQQSRGWVHYAIHRPEPHIMLFRRPLNYQQQQENQAQQNMLAK 132 >ref|XP_011009277.1| PREDICTED: cyclin-dependent kinases regulatory subunit 1 [Populus euphratica] gi|743930073|ref|XP_011009278.1| PREDICTED: cyclin-dependent kinases regulatory subunit 1 [Populus euphratica] Length = 84 Score = 79.3 bits (194), Expect = 2e-17 Identities = 34/39 (87%), Positives = 37/39 (94%) Frame = -1 Query: 350 VQQSRGWVHYAVHRPEPHIMLFRRPLNYQQQQEQNMLAK 234 VQQSRGWVHYA+HRPEPHIMLFRRPLN+QQQQE +LAK Sbjct: 46 VQQSRGWVHYAIHRPEPHIMLFRRPLNFQQQQENQVLAK 84 >gb|ABK94640.1| unknown [Populus trichocarpa] Length = 84 Score = 79.3 bits (194), Expect = 2e-17 Identities = 34/39 (87%), Positives = 37/39 (94%) Frame = -1 Query: 350 VQQSRGWVHYAVHRPEPHIMLFRRPLNYQQQQEQNMLAK 234 VQQSRGWVHYA+HRPEPHIMLFRRPLN+QQQQE +LAK Sbjct: 46 VQQSRGWVHYAIHRPEPHIMLFRRPLNFQQQQENQVLAK 84 >ref|XP_002523737.1| PREDICTED: cyclin-dependent kinases regulatory subunit 1 [Ricinus communis] gi|223537041|gb|EEF38677.1| Cyclin-dependent kinases regulatory subunit, putative [Ricinus communis] Length = 88 Score = 79.3 bits (194), Expect = 3e-17 Identities = 37/43 (86%), Positives = 39/43 (90%), Gaps = 4/43 (9%) Frame = -1 Query: 350 VQQSRGWVHYAVHRPEPHIMLFRRPLNYQQQQE----QNMLAK 234 VQQSRGWVHYA+HRPEPHIMLFRRPLNYQQQQE QN+LAK Sbjct: 46 VQQSRGWVHYAIHRPEPHIMLFRRPLNYQQQQENQAQQNILAK 88 >ref|XP_006424430.1| hypothetical protein CICLE_v10029696mg [Citrus clementina] gi|567863554|ref|XP_006424431.1| hypothetical protein CICLE_v10029696mg [Citrus clementina] gi|567863556|ref|XP_006424432.1| hypothetical protein CICLE_v10029696mg [Citrus clementina] gi|568869571|ref|XP_006487994.1| PREDICTED: cyclin-dependent kinases regulatory subunit 1 [Citrus sinensis] gi|557526364|gb|ESR37670.1| hypothetical protein CICLE_v10029696mg [Citrus clementina] gi|557526365|gb|ESR37671.1| hypothetical protein CICLE_v10029696mg [Citrus clementina] gi|557526366|gb|ESR37672.1| hypothetical protein CICLE_v10029696mg [Citrus clementina] gi|641841386|gb|KDO60299.1| hypothetical protein CISIN_1g034642mg [Citrus sinensis] gi|641841387|gb|KDO60300.1| hypothetical protein CISIN_1g034642mg [Citrus sinensis] Length = 88 Score = 79.3 bits (194), Expect = 3e-17 Identities = 37/43 (86%), Positives = 39/43 (90%), Gaps = 4/43 (9%) Frame = -1 Query: 350 VQQSRGWVHYAVHRPEPHIMLFRRPLNYQQQQE----QNMLAK 234 VQQSRGWVHYA+HRPEPHIMLFRRPLNYQQQQE QN+LAK Sbjct: 46 VQQSRGWVHYAIHRPEPHIMLFRRPLNYQQQQENQAQQNILAK 88 >ref|XP_012444712.1| PREDICTED: cyclin-dependent kinases regulatory subunit 1 [Gossypium raimondii] gi|823223914|ref|XP_012444713.1| PREDICTED: cyclin-dependent kinases regulatory subunit 1 [Gossypium raimondii] gi|763786549|gb|KJB53545.1| hypothetical protein B456_009G089700 [Gossypium raimondii] gi|763786550|gb|KJB53546.1| hypothetical protein B456_009G089700 [Gossypium raimondii] gi|763786551|gb|KJB53547.1| hypothetical protein B456_009G089700 [Gossypium raimondii] Length = 88 Score = 79.0 bits (193), Expect = 4e-17 Identities = 37/43 (86%), Positives = 39/43 (90%), Gaps = 4/43 (9%) Frame = -1 Query: 350 VQQSRGWVHYAVHRPEPHIMLFRRPLNYQQQQE----QNMLAK 234 VQQSRGWVHYA+HRPEPHIMLFRRPLNYQQQQE Q+MLAK Sbjct: 46 VQQSRGWVHYAIHRPEPHIMLFRRPLNYQQQQENQAQQSMLAK 88 >ref|XP_010267302.1| PREDICTED: cyclin-dependent kinases regulatory subunit 1 [Nelumbo nucifera] gi|720036283|ref|XP_010267303.1| PREDICTED: cyclin-dependent kinases regulatory subunit 1 [Nelumbo nucifera] gi|720036286|ref|XP_010267305.1| PREDICTED: cyclin-dependent kinases regulatory subunit 1 [Nelumbo nucifera] gi|720036289|ref|XP_010267306.1| PREDICTED: cyclin-dependent kinases regulatory subunit 1 [Nelumbo nucifera] Length = 88 Score = 78.6 bits (192), Expect = 5e-17 Identities = 37/43 (86%), Positives = 38/43 (88%), Gaps = 4/43 (9%) Frame = -1 Query: 350 VQQSRGWVHYAVHRPEPHIMLFRRPLNYQQQQE----QNMLAK 234 VQQSRGWVHYA+HRPEPHIMLFRRPLNYQQQQE Q MLAK Sbjct: 46 VQQSRGWVHYAIHRPEPHIMLFRRPLNYQQQQENQAQQQMLAK 88 >ref|XP_010417949.1| PREDICTED: cyclin-dependent kinases regulatory subunit 1 [Camelina sativa] Length = 87 Score = 78.2 bits (191), Expect = 8e-17 Identities = 36/42 (85%), Positives = 38/42 (90%), Gaps = 3/42 (7%) Frame = -1 Query: 350 VQQSRGWVHYAVHRPEPHIMLFRRPLNYQQQQE---QNMLAK 234 VQQSRGWVHYA+HRPEPHIMLFRRPLNYQQQQE QN+L K Sbjct: 46 VQQSRGWVHYAIHRPEPHIMLFRRPLNYQQQQEIQAQNVLVK 87 >ref|XP_010510708.1| PREDICTED: cyclin-dependent kinases regulatory subunit 1-like [Camelina sativa] Length = 87 Score = 78.2 bits (191), Expect = 8e-17 Identities = 36/42 (85%), Positives = 38/42 (90%), Gaps = 3/42 (7%) Frame = -1 Query: 350 VQQSRGWVHYAVHRPEPHIMLFRRPLNYQQQQE---QNMLAK 234 VQQSRGWVHYA+HRPEPHIMLFRRPLNYQQQQE QN+L K Sbjct: 46 VQQSRGWVHYAIHRPEPHIMLFRRPLNYQQQQEIQAQNVLVK 87 >ref|XP_010542578.1| PREDICTED: cyclin-dependent kinases regulatory subunit 1 [Tarenaya hassleriana] Length = 87 Score = 77.8 bits (190), Expect = 1e-16 Identities = 33/35 (94%), Positives = 35/35 (100%) Frame = -1 Query: 350 VQQSRGWVHYAVHRPEPHIMLFRRPLNYQQQQEQN 246 VQQSRGWVHYAVHRPEPHIMLFRRPLNYQQQQ++N Sbjct: 46 VQQSRGWVHYAVHRPEPHIMLFRRPLNYQQQQQEN 80 >gb|KHG01535.1| Cyclin-dependent kinases regulatory subunit 1 [Gossypium arboreum] gi|728850106|gb|KHG29549.1| Cyclin-dependent kinases regulatory subunit 1 [Gossypium arboreum] Length = 88 Score = 77.8 bits (190), Expect = 1e-16 Identities = 36/43 (83%), Positives = 39/43 (90%), Gaps = 4/43 (9%) Frame = -1 Query: 350 VQQSRGWVHYAVHRPEPHIMLFRRPLNYQQQQE----QNMLAK 234 VQQSRGWVHYA+HRPEPHIMLFRRPLNYQQQQE Q+ML+K Sbjct: 46 VQQSRGWVHYAIHRPEPHIMLFRRPLNYQQQQENQAQQSMLSK 88 >ref|XP_012475898.1| PREDICTED: cyclin-dependent kinases regulatory subunit 1-like [Gossypium raimondii] gi|823123488|ref|XP_012475905.1| PREDICTED: cyclin-dependent kinases regulatory subunit 1-like [Gossypium raimondii] gi|728843603|gb|KHG23046.1| Cyclin-dependent kinases regulatory subunit 1 [Gossypium arboreum] gi|763741492|gb|KJB08991.1| hypothetical protein B456_001G117400 [Gossypium raimondii] gi|763741493|gb|KJB08992.1| hypothetical protein B456_001G117400 [Gossypium raimondii] Length = 88 Score = 77.8 bits (190), Expect = 1e-16 Identities = 37/43 (86%), Positives = 38/43 (88%), Gaps = 4/43 (9%) Frame = -1 Query: 350 VQQSRGWVHYAVHRPEPHIMLFRRPLNYQQQQE----QNMLAK 234 VQQSRGWVHYA+HRPEPHIMLFRRPLNYQQQQE Q MLAK Sbjct: 46 VQQSRGWVHYAIHRPEPHIMLFRRPLNYQQQQENQAQQAMLAK 88 >ref|XP_010241657.1| PREDICTED: cyclin-dependent kinases regulatory subunit 1-like [Nelumbo nucifera] Length = 88 Score = 77.8 bits (190), Expect = 1e-16 Identities = 36/43 (83%), Positives = 39/43 (90%), Gaps = 4/43 (9%) Frame = -1 Query: 350 VQQSRGWVHYAVHRPEPHIMLFRRPLNYQQQQE----QNMLAK 234 VQQSRGWVHYA+HRPEPHIMLFRRPLNYQQQQE Q++LAK Sbjct: 46 VQQSRGWVHYAIHRPEPHIMLFRRPLNYQQQQENHVQQHLLAK 88 >ref|XP_009592163.1| PREDICTED: cyclin-dependent kinases regulatory subunit 1 [Nicotiana tomentosiformis] gi|698522223|ref|XP_009757926.1| PREDICTED: cyclin-dependent kinases regulatory subunit 1 [Nicotiana sylvestris] Length = 88 Score = 77.8 bits (190), Expect = 1e-16 Identities = 37/43 (86%), Positives = 38/43 (88%), Gaps = 4/43 (9%) Frame = -1 Query: 350 VQQSRGWVHYAVHRPEPHIMLFRRPLNYQQQQE----QNMLAK 234 VQQSRGWVHYA+HRPEPHIMLFRRPLNYQQQQE Q MLAK Sbjct: 46 VQQSRGWVHYAIHRPEPHIMLFRRPLNYQQQQENQAQQAMLAK 88