BLASTX nr result
ID: Rehmannia27_contig00018293
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia27_contig00018293 (413 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU44379.1| hypothetical protein MIMGU_mgv1a000382mg [Erythra... 57 9e-07 ref|XP_012853267.1| PREDICTED: transmembrane protein 131 homolog... 57 9e-07 >gb|EYU44379.1| hypothetical protein MIMGU_mgv1a000382mg [Erythranthe guttata] Length = 1199 Score = 56.6 bits (135), Expect = 9e-07 Identities = 30/62 (48%), Positives = 36/62 (58%) Frame = +2 Query: 224 IEISSAAKNSRGSSDTSSKASFVDNKVSCLSAQEKSIITRKFAGKAVLLPSATFPSACRT 403 +E S S S K + +DN+V A EK +T+K AGKAVLLPSATFPSA R Sbjct: 1032 VEAKSPFSQKTDKSKCSPKVNILDNEVRSNCAPEKPSLTKKVAGKAVLLPSATFPSAVRA 1091 Query: 404 TP 409 P Sbjct: 1092 VP 1093 >ref|XP_012853267.1| PREDICTED: transmembrane protein 131 homolog [Erythranthe guttata] Length = 1234 Score = 56.6 bits (135), Expect = 9e-07 Identities = 30/62 (48%), Positives = 36/62 (58%) Frame = +2 Query: 224 IEISSAAKNSRGSSDTSSKASFVDNKVSCLSAQEKSIITRKFAGKAVLLPSATFPSACRT 403 +E S S S K + +DN+V A EK +T+K AGKAVLLPSATFPSA R Sbjct: 1067 VEAKSPFSQKTDKSKCSPKVNILDNEVRSNCAPEKPSLTKKVAGKAVLLPSATFPSAVRA 1126 Query: 404 TP 409 P Sbjct: 1127 VP 1128