BLASTX nr result
ID: Rehmannia27_contig00018214
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia27_contig00018214 (716 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_012830370.1| PREDICTED: serine/threonine-protein kinase H... 59 1e-06 ref|XP_011086066.1| PREDICTED: serine/threonine-protein kinase H... 57 7e-06 gb|ACU15717.1| unknown [Glycine max] 52 8e-06 >ref|XP_012830370.1| PREDICTED: serine/threonine-protein kinase HT1 [Erythranthe guttata] gi|604344634|gb|EYU43388.1| hypothetical protein MIMGU_mgv1a005321mg [Erythranthe guttata] Length = 489 Score = 58.9 bits (141), Expect = 1e-06 Identities = 24/30 (80%), Positives = 28/30 (93%) Frame = +1 Query: 625 MEEEATSWIRRTKFSHTVCHRFDPSRLNTV 714 M+EEATSWIRRTKFSHT+CHR DPSRL ++ Sbjct: 1 MDEEATSWIRRTKFSHTICHRIDPSRLASI 30 >ref|XP_011086066.1| PREDICTED: serine/threonine-protein kinase HT1 [Sesamum indicum] gi|747077847|ref|XP_011086067.1| PREDICTED: serine/threonine-protein kinase HT1 [Sesamum indicum] gi|747077849|ref|XP_011086068.1| PREDICTED: serine/threonine-protein kinase HT1 [Sesamum indicum] gi|747077851|ref|XP_011086069.1| PREDICTED: serine/threonine-protein kinase HT1 [Sesamum indicum] Length = 495 Score = 56.6 bits (135), Expect = 7e-06 Identities = 25/30 (83%), Positives = 26/30 (86%) Frame = +1 Query: 625 MEEEATSWIRRTKFSHTVCHRFDPSRLNTV 714 MEEE TSWIRRT FSHTVCHRFD SRL +V Sbjct: 1 MEEETTSWIRRTNFSHTVCHRFDSSRLASV 30 >gb|ACU15717.1| unknown [Glycine max] Length = 68 Score = 52.0 bits (123), Expect = 8e-06 Identities = 21/30 (70%), Positives = 25/30 (83%) Frame = +1 Query: 625 MEEEATSWIRRTKFSHTVCHRFDPSRLNTV 714 M E+ SWIRRTKFSHTVCHR DP+RL ++ Sbjct: 1 MGEDGYSWIRRTKFSHTVCHRLDPARLGSI 30