BLASTX nr result
ID: Rehmannia27_contig00018206
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia27_contig00018206 (423 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011088279.1| PREDICTED: presequence protease 1, chloropla... 69 7e-11 ref|XP_012836960.1| PREDICTED: presequence protease 1, chloropla... 56 2e-06 >ref|XP_011088279.1| PREDICTED: presequence protease 1, chloroplastic/mitochondrial-like [Sesamum indicum] Length = 1078 Score = 68.6 bits (166), Expect = 7e-11 Identities = 32/36 (88%), Positives = 35/36 (97%) Frame = -1 Query: 108 RLPKRHRLVPNVHRRSLLRRHLGFISPVSRPSLQLN 1 RLP+RHRLVPNVH+RSLLRRHLGFIS VSRPSLQL+ Sbjct: 35 RLPRRHRLVPNVHQRSLLRRHLGFISAVSRPSLQLS 70 >ref|XP_012836960.1| PREDICTED: presequence protease 1, chloroplastic/mitochondrial [Erythranthe guttata] Length = 1080 Score = 55.8 bits (133), Expect = 2e-06 Identities = 30/42 (71%), Positives = 34/42 (80%), Gaps = 6/42 (14%) Frame = -1 Query: 111 HRL---PKRHRLVPNVHRRSLLRRHLGFI---SPVSRPSLQL 4 HRL PKRHRLVPNVH+RS+LRRHLG + S VSRPS+QL Sbjct: 30 HRLAHIPKRHRLVPNVHQRSILRRHLGGVGLYSSVSRPSVQL 71