BLASTX nr result
ID: Rehmannia27_contig00018162
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia27_contig00018162 (562 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EEF26699.1| dead box ATP-dependent RNA helicase, putative [Ri... 73 1e-13 ref|XP_002535684.2| PREDICTED: DEAD-box ATP-dependent RNA helica... 73 1e-13 gb|ACF86701.1| unknown [Zea mays] 73 1e-13 gb|KQL13994.1| hypothetical protein SETIT_025481mg [Setaria ital... 73 7e-13 dbj|BAS72633.1| Os01g0549700, partial [Oryza sativa Japonica Group] 73 2e-12 ref|XP_012700219.1| PREDICTED: DEAD-box ATP-dependent RNA helica... 73 5e-12 ref|XP_012462593.1| PREDICTED: DEAD-box ATP-dependent RNA helica... 73 5e-12 gb|KJB54997.1| hypothetical protein B456_009G057600 [Gossypium r... 73 5e-12 ref|XP_012477379.1| PREDICTED: DEAD-box ATP-dependent RNA helica... 73 5e-12 ref|XP_011081571.1| PREDICTED: DEAD-box ATP-dependent RNA helica... 73 5e-12 ref|XP_011070543.1| PREDICTED: DEAD-box ATP-dependent RNA helica... 73 5e-12 ref|XP_010696055.1| PREDICTED: DEAD-box ATP-dependent RNA helica... 73 5e-12 ref|XP_012451182.1| PREDICTED: DEAD-box ATP-dependent RNA helica... 73 5e-12 ref|XP_010231903.1| PREDICTED: DEAD-box ATP-dependent RNA helica... 73 5e-12 ref|XP_010231902.1| PREDICTED: DEAD-box ATP-dependent RNA helica... 73 5e-12 ref|XP_009606367.1| PREDICTED: DEAD-box ATP-dependent RNA helica... 73 5e-12 ref|XP_009412247.1| PREDICTED: DEAD-box ATP-dependent RNA helica... 73 5e-12 ref|XP_009392979.1| PREDICTED: DEAD-box ATP-dependent RNA helica... 73 5e-12 ref|XP_008797872.1| PREDICTED: DEAD-box ATP-dependent RNA helica... 73 5e-12 ref|XP_008806610.1| PREDICTED: DEAD-box ATP-dependent RNA helica... 73 5e-12 >gb|EEF26699.1| dead box ATP-dependent RNA helicase, putative [Ricinus communis] Length = 105 Score = 72.8 bits (177), Expect = 1e-13 Identities = 36/36 (100%), Positives = 36/36 (100%) Frame = -3 Query: 560 VSSASDSDVLNQVQERFEVDIKELPEQIDTSTYMPS 453 VSSASDSDVLNQVQERFEVDIKELPEQIDTSTYMPS Sbjct: 70 VSSASDSDVLNQVQERFEVDIKELPEQIDTSTYMPS 105 >ref|XP_002535684.2| PREDICTED: DEAD-box ATP-dependent RNA helicase 56 [Ricinus communis] Length = 106 Score = 72.8 bits (177), Expect = 1e-13 Identities = 36/36 (100%), Positives = 36/36 (100%) Frame = -3 Query: 560 VSSASDSDVLNQVQERFEVDIKELPEQIDTSTYMPS 453 VSSASDSDVLNQVQERFEVDIKELPEQIDTSTYMPS Sbjct: 71 VSSASDSDVLNQVQERFEVDIKELPEQIDTSTYMPS 106 >gb|ACF86701.1| unknown [Zea mays] Length = 106 Score = 72.8 bits (177), Expect = 1e-13 Identities = 36/36 (100%), Positives = 36/36 (100%) Frame = -3 Query: 560 VSSASDSDVLNQVQERFEVDIKELPEQIDTSTYMPS 453 VSSASDSDVLNQVQERFEVDIKELPEQIDTSTYMPS Sbjct: 71 VSSASDSDVLNQVQERFEVDIKELPEQIDTSTYMPS 106 >gb|KQL13994.1| hypothetical protein SETIT_025481mg [Setaria italica] Length = 180 Score = 72.8 bits (177), Expect = 7e-13 Identities = 36/36 (100%), Positives = 36/36 (100%) Frame = -3 Query: 560 VSSASDSDVLNQVQERFEVDIKELPEQIDTSTYMPS 453 VSSASDSDVLNQVQERFEVDIKELPEQIDTSTYMPS Sbjct: 145 VSSASDSDVLNQVQERFEVDIKELPEQIDTSTYMPS 180 >dbj|BAS72633.1| Os01g0549700, partial [Oryza sativa Japonica Group] Length = 231 Score = 72.8 bits (177), Expect = 2e-12 Identities = 36/36 (100%), Positives = 36/36 (100%) Frame = -3 Query: 560 VSSASDSDVLNQVQERFEVDIKELPEQIDTSTYMPS 453 VSSASDSDVLNQVQERFEVDIKELPEQIDTSTYMPS Sbjct: 196 VSSASDSDVLNQVQERFEVDIKELPEQIDTSTYMPS 231 >ref|XP_012700219.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 15 isoform X2 [Setaria italica] gi|944249732|gb|KQL13995.1| hypothetical protein SETIT_025481mg [Setaria italica] gi|944249735|gb|KQL13998.1| hypothetical protein SETIT_025481mg [Setaria italica] Length = 344 Score = 72.8 bits (177), Expect = 5e-12 Identities = 36/36 (100%), Positives = 36/36 (100%) Frame = -3 Query: 560 VSSASDSDVLNQVQERFEVDIKELPEQIDTSTYMPS 453 VSSASDSDVLNQVQERFEVDIKELPEQIDTSTYMPS Sbjct: 309 VSSASDSDVLNQVQERFEVDIKELPEQIDTSTYMPS 344 >ref|XP_012462593.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 56 isoform X2 [Gossypium raimondii] Length = 344 Score = 72.8 bits (177), Expect = 5e-12 Identities = 36/36 (100%), Positives = 36/36 (100%) Frame = -3 Query: 560 VSSASDSDVLNQVQERFEVDIKELPEQIDTSTYMPS 453 VSSASDSDVLNQVQERFEVDIKELPEQIDTSTYMPS Sbjct: 309 VSSASDSDVLNQVQERFEVDIKELPEQIDTSTYMPS 344 >gb|KJB54997.1| hypothetical protein B456_009G057600 [Gossypium raimondii] Length = 344 Score = 72.8 bits (177), Expect = 5e-12 Identities = 36/36 (100%), Positives = 36/36 (100%) Frame = -3 Query: 560 VSSASDSDVLNQVQERFEVDIKELPEQIDTSTYMPS 453 VSSASDSDVLNQVQERFEVDIKELPEQIDTSTYMPS Sbjct: 309 VSSASDSDVLNQVQERFEVDIKELPEQIDTSTYMPS 344 >ref|XP_012477379.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 56-like isoform X2 [Gossypium raimondii] gi|763760018|gb|KJB27349.1| hypothetical protein B456_004G292500 [Gossypium raimondii] Length = 344 Score = 72.8 bits (177), Expect = 5e-12 Identities = 36/36 (100%), Positives = 36/36 (100%) Frame = -3 Query: 560 VSSASDSDVLNQVQERFEVDIKELPEQIDTSTYMPS 453 VSSASDSDVLNQVQERFEVDIKELPEQIDTSTYMPS Sbjct: 309 VSSASDSDVLNQVQERFEVDIKELPEQIDTSTYMPS 344 >ref|XP_011081571.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 56-like isoform X2 [Sesamum indicum] Length = 344 Score = 72.8 bits (177), Expect = 5e-12 Identities = 36/36 (100%), Positives = 36/36 (100%) Frame = -3 Query: 560 VSSASDSDVLNQVQERFEVDIKELPEQIDTSTYMPS 453 VSSASDSDVLNQVQERFEVDIKELPEQIDTSTYMPS Sbjct: 309 VSSASDSDVLNQVQERFEVDIKELPEQIDTSTYMPS 344 >ref|XP_011070543.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 56 isoform X2 [Sesamum indicum] Length = 344 Score = 72.8 bits (177), Expect = 5e-12 Identities = 36/36 (100%), Positives = 36/36 (100%) Frame = -3 Query: 560 VSSASDSDVLNQVQERFEVDIKELPEQIDTSTYMPS 453 VSSASDSDVLNQVQERFEVDIKELPEQIDTSTYMPS Sbjct: 309 VSSASDSDVLNQVQERFEVDIKELPEQIDTSTYMPS 344 >ref|XP_010696055.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 56 isoform X2 [Beta vulgaris subsp. vulgaris] Length = 344 Score = 72.8 bits (177), Expect = 5e-12 Identities = 36/36 (100%), Positives = 36/36 (100%) Frame = -3 Query: 560 VSSASDSDVLNQVQERFEVDIKELPEQIDTSTYMPS 453 VSSASDSDVLNQVQERFEVDIKELPEQIDTSTYMPS Sbjct: 309 VSSASDSDVLNQVQERFEVDIKELPEQIDTSTYMPS 344 >ref|XP_012451182.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 56-like isoform X2 [Gossypium raimondii] gi|728821494|gb|KHG04361.1| DEAD-box ATP-dependent RNA helicase 56 [Gossypium arboreum] gi|763798858|gb|KJB65813.1| hypothetical protein B456_010G114300 [Gossypium raimondii] Length = 344 Score = 72.8 bits (177), Expect = 5e-12 Identities = 36/36 (100%), Positives = 36/36 (100%) Frame = -3 Query: 560 VSSASDSDVLNQVQERFEVDIKELPEQIDTSTYMPS 453 VSSASDSDVLNQVQERFEVDIKELPEQIDTSTYMPS Sbjct: 309 VSSASDSDVLNQVQERFEVDIKELPEQIDTSTYMPS 344 >ref|XP_010231903.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 15-like isoform X2 [Brachypodium distachyon] Length = 344 Score = 72.8 bits (177), Expect = 5e-12 Identities = 36/36 (100%), Positives = 36/36 (100%) Frame = -3 Query: 560 VSSASDSDVLNQVQERFEVDIKELPEQIDTSTYMPS 453 VSSASDSDVLNQVQERFEVDIKELPEQIDTSTYMPS Sbjct: 309 VSSASDSDVLNQVQERFEVDIKELPEQIDTSTYMPS 344 >ref|XP_010231902.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 15-like isoform X2 [Brachypodium distachyon] Length = 344 Score = 72.8 bits (177), Expect = 5e-12 Identities = 36/36 (100%), Positives = 36/36 (100%) Frame = -3 Query: 560 VSSASDSDVLNQVQERFEVDIKELPEQIDTSTYMPS 453 VSSASDSDVLNQVQERFEVDIKELPEQIDTSTYMPS Sbjct: 309 VSSASDSDVLNQVQERFEVDIKELPEQIDTSTYMPS 344 >ref|XP_009606367.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 56 isoform X2 [Nicotiana tomentosiformis] Length = 344 Score = 72.8 bits (177), Expect = 5e-12 Identities = 36/36 (100%), Positives = 36/36 (100%) Frame = -3 Query: 560 VSSASDSDVLNQVQERFEVDIKELPEQIDTSTYMPS 453 VSSASDSDVLNQVQERFEVDIKELPEQIDTSTYMPS Sbjct: 309 VSSASDSDVLNQVQERFEVDIKELPEQIDTSTYMPS 344 >ref|XP_009412247.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 15 isoform X2 [Musa acuminata subsp. malaccensis] Length = 344 Score = 72.8 bits (177), Expect = 5e-12 Identities = 36/36 (100%), Positives = 36/36 (100%) Frame = -3 Query: 560 VSSASDSDVLNQVQERFEVDIKELPEQIDTSTYMPS 453 VSSASDSDVLNQVQERFEVDIKELPEQIDTSTYMPS Sbjct: 309 VSSASDSDVLNQVQERFEVDIKELPEQIDTSTYMPS 344 >ref|XP_009392979.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 15-like isoform X2 [Musa acuminata subsp. malaccensis] Length = 344 Score = 72.8 bits (177), Expect = 5e-12 Identities = 36/36 (100%), Positives = 36/36 (100%) Frame = -3 Query: 560 VSSASDSDVLNQVQERFEVDIKELPEQIDTSTYMPS 453 VSSASDSDVLNQVQERFEVDIKELPEQIDTSTYMPS Sbjct: 309 VSSASDSDVLNQVQERFEVDIKELPEQIDTSTYMPS 344 >ref|XP_008797872.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 56-like isoform X2 [Phoenix dactylifera] Length = 344 Score = 72.8 bits (177), Expect = 5e-12 Identities = 36/36 (100%), Positives = 36/36 (100%) Frame = -3 Query: 560 VSSASDSDVLNQVQERFEVDIKELPEQIDTSTYMPS 453 VSSASDSDVLNQVQERFEVDIKELPEQIDTSTYMPS Sbjct: 309 VSSASDSDVLNQVQERFEVDIKELPEQIDTSTYMPS 344 >ref|XP_008806610.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 15 isoform X2 [Phoenix dactylifera] Length = 344 Score = 72.8 bits (177), Expect = 5e-12 Identities = 36/36 (100%), Positives = 36/36 (100%) Frame = -3 Query: 560 VSSASDSDVLNQVQERFEVDIKELPEQIDTSTYMPS 453 VSSASDSDVLNQVQERFEVDIKELPEQIDTSTYMPS Sbjct: 309 VSSASDSDVLNQVQERFEVDIKELPEQIDTSTYMPS 344