BLASTX nr result
ID: Rehmannia27_contig00018137
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia27_contig00018137 (1779 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ERM99681.1| hypothetical protein AMTR_s00099p00051410 [Ambore... 60 1e-06 >gb|ERM99681.1| hypothetical protein AMTR_s00099p00051410 [Amborella trichopoda] Length = 258 Score = 60.5 bits (145), Expect = 1e-06 Identities = 28/38 (73%), Positives = 33/38 (86%) Frame = -3 Query: 1774 SKERTVRITGNKKQIETAREMIKDVMNQVCLDVFPSFL 1661 SKERTV +TGNKKQIETA+EMIK+VMNQVC +P +L Sbjct: 200 SKERTVHVTGNKKQIETAQEMIKEVMNQVCEGAWPIYL 237