BLASTX nr result
ID: Rehmannia27_contig00017911
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia27_contig00017911 (681 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011083948.1| PREDICTED: uncharacterized protein LOC105166... 58 1e-09 >ref|XP_011083948.1| PREDICTED: uncharacterized protein LOC105166332 [Sesamum indicum] Length = 304 Score = 57.8 bits (138), Expect(2) = 1e-09 Identities = 29/45 (64%), Positives = 34/45 (75%), Gaps = 5/45 (11%) Frame = -3 Query: 670 MSKKNKGVVR-----FGVGVYEDAKARSRHQDLIMDYEELLRETD 551 MSKK+KG V +GVGVYEDAKAR +HQ L+ DYEEL +ETD Sbjct: 1 MSKKSKGAVLDSTPPYGVGVYEDAKARLKHQTLVQDYEELQKETD 45 Score = 32.7 bits (73), Expect(2) = 1e-09 Identities = 15/22 (68%), Positives = 19/22 (86%) Frame = -1 Query: 549 LLSSKLDLANQRKLILAAEVRY 484 ++ SKL+ A QRKLILAAEVR+ Sbjct: 46 VMKSKLEAAKQRKLILAAEVRF 67