BLASTX nr result
ID: Rehmannia27_contig00016816
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia27_contig00016816 (469 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011071183.1| PREDICTED: serine/threonine protein phosphat... 59 2e-07 >ref|XP_011071183.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory subunit B' theta isoform-like [Sesamum indicum] Length = 509 Score = 59.3 bits (142), Expect = 2e-07 Identities = 34/49 (69%), Positives = 38/49 (77%), Gaps = 10/49 (20%) Frame = +3 Query: 351 MLKQILGKIPKKHSKSAGDS-------TTSKRSEGGSKK---SVDEAIS 467 M+KQILGKIP+KHSKS+GD TTSKRSEGGSK+ SVDEAIS Sbjct: 1 MIKQILGKIPRKHSKSSGDPSHSASSVTTSKRSEGGSKRLSSSVDEAIS 49