BLASTX nr result
ID: Rehmannia27_contig00016585
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia27_contig00016585 (531 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011075549.1| PREDICTED: probable protein S-acyltransferas... 74 2e-12 ref|XP_011075548.1| PREDICTED: probable protein S-acyltransferas... 74 2e-12 gb|EYU28813.1| hypothetical protein MIMGU_mgv1a003797mg [Erythra... 61 8e-08 ref|XP_012847659.1| PREDICTED: probable protein S-acyltransferas... 61 8e-08 >ref|XP_011075549.1| PREDICTED: probable protein S-acyltransferase 22 isoform X2 [Sesamum indicum] Length = 576 Score = 74.3 bits (181), Expect = 2e-12 Identities = 34/39 (87%), Positives = 37/39 (94%) Frame = -1 Query: 531 RILHRSNNWSSLLFGSEPDRNGSKFLPPSSSTLSSHRKV 415 RI HRSNNWSSLLFGSEPDRN SKF+PPSSSTLS+HRK+ Sbjct: 538 RIQHRSNNWSSLLFGSEPDRNMSKFMPPSSSTLSNHRKL 576 >ref|XP_011075548.1| PREDICTED: probable protein S-acyltransferase 22 isoform X1 [Sesamum indicum] Length = 627 Score = 74.3 bits (181), Expect = 2e-12 Identities = 34/39 (87%), Positives = 37/39 (94%) Frame = -1 Query: 531 RILHRSNNWSSLLFGSEPDRNGSKFLPPSSSTLSSHRKV 415 RI HRSNNWSSLLFGSEPDRN SKF+PPSSSTLS+HRK+ Sbjct: 589 RIQHRSNNWSSLLFGSEPDRNMSKFMPPSSSTLSNHRKL 627 >gb|EYU28813.1| hypothetical protein MIMGU_mgv1a003797mg [Erythranthe guttata] Length = 563 Score = 60.8 bits (146), Expect = 8e-08 Identities = 28/38 (73%), Positives = 36/38 (94%) Frame = -1 Query: 531 RILHRSNNWSSLLFGSEPDRNGSKFLPPSSSTLSSHRK 418 RI++RS+NWSSLLFGSEPDRN SK++PPSSS+ ++HRK Sbjct: 526 RIMNRSSNWSSLLFGSEPDRNVSKYMPPSSSS-NNHRK 562 >ref|XP_012847659.1| PREDICTED: probable protein S-acyltransferase 22 [Erythranthe guttata] Length = 610 Score = 60.8 bits (146), Expect = 8e-08 Identities = 28/38 (73%), Positives = 36/38 (94%) Frame = -1 Query: 531 RILHRSNNWSSLLFGSEPDRNGSKFLPPSSSTLSSHRK 418 RI++RS+NWSSLLFGSEPDRN SK++PPSSS+ ++HRK Sbjct: 573 RIMNRSSNWSSLLFGSEPDRNVSKYMPPSSSS-NNHRK 609