BLASTX nr result
ID: Rehmannia27_contig00016454
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia27_contig00016454 (458 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011073490.1| PREDICTED: uncharacterized protein LOC105158... 84 5e-16 gb|EYU32519.1| hypothetical protein MIMGU_mgv1a004371mg [Erythra... 74 8e-13 ref|XP_012842830.1| PREDICTED: uncharacterized protein LOC105963... 74 9e-13 ref|XP_012842828.1| PREDICTED: uncharacterized protein LOC105963... 74 9e-13 gb|EYU32993.1| hypothetical protein MIMGU_mgv1a004259mg [Erythra... 66 7e-10 ref|XP_012842681.1| PREDICTED: uncharacterized protein LOC105962... 66 8e-10 ref|XP_012842680.1| PREDICTED: uncharacterized protein LOC105962... 66 8e-10 ref|XP_011091141.1| PREDICTED: uncharacterized protein LOC105171... 65 2e-09 ref|XP_011091140.1| PREDICTED: uncharacterized protein LOC105171... 65 2e-09 ref|XP_011091136.1| PREDICTED: uncharacterized protein LOC105171... 65 2e-09 ref|XP_007034986.1| Zinc knuckle family protein, putative isofor... 57 1e-06 ref|XP_007034984.1| Zinc knuckle family protein, putative isofor... 57 1e-06 ref|XP_009794185.1| PREDICTED: uncharacterized protein LOC104240... 56 2e-06 emb|CDP19496.1| unnamed protein product [Coffea canephora] 53 2e-06 emb|CDP21989.1| unnamed protein product [Coffea canephora] 53 6e-06 ref|XP_010274164.1| PREDICTED: uncharacterized protein LOC104609... 54 8e-06 ref|XP_010274162.1| PREDICTED: uncharacterized protein LOC104609... 54 8e-06 >ref|XP_011073490.1| PREDICTED: uncharacterized protein LOC105158430 [Sesamum indicum] Length = 657 Score = 83.6 bits (205), Expect = 5e-16 Identities = 36/40 (90%), Positives = 38/40 (95%) Frame = -1 Query: 458 HDFLEDEIKAWWCRTLDSGCKIPSLDELNSKLNDRKSLGF 339 HDFLEDEIKAWWCR L SGC+IPSLDELNSK+NDRKSLGF Sbjct: 618 HDFLEDEIKAWWCRILKSGCRIPSLDELNSKINDRKSLGF 657 >gb|EYU32519.1| hypothetical protein MIMGU_mgv1a004371mg [Erythranthe guttata] Length = 531 Score = 74.3 bits (181), Expect = 8e-13 Identities = 32/39 (82%), Positives = 35/39 (89%) Frame = -1 Query: 455 DFLEDEIKAWWCRTLDSGCKIPSLDELNSKLNDRKSLGF 339 +FLEDEI+AWWCR +DSGCKIPSLDELNSKL DR LGF Sbjct: 493 EFLEDEIEAWWCRIMDSGCKIPSLDELNSKLKDRHILGF 531 >ref|XP_012842830.1| PREDICTED: uncharacterized protein LOC105963021 isoform X2 [Erythranthe guttata] Length = 695 Score = 74.3 bits (181), Expect = 9e-13 Identities = 32/39 (82%), Positives = 35/39 (89%) Frame = -1 Query: 455 DFLEDEIKAWWCRTLDSGCKIPSLDELNSKLNDRKSLGF 339 +FLEDEI+AWWCR +DSGCKIPSLDELNSKL DR LGF Sbjct: 657 EFLEDEIEAWWCRIMDSGCKIPSLDELNSKLKDRHILGF 695 >ref|XP_012842828.1| PREDICTED: uncharacterized protein LOC105963021 isoform X1 [Erythranthe guttata] Length = 696 Score = 74.3 bits (181), Expect = 9e-13 Identities = 32/39 (82%), Positives = 35/39 (89%) Frame = -1 Query: 455 DFLEDEIKAWWCRTLDSGCKIPSLDELNSKLNDRKSLGF 339 +FLEDEI+AWWCR +DSGCKIPSLDELNSKL DR LGF Sbjct: 658 EFLEDEIEAWWCRIMDSGCKIPSLDELNSKLKDRHILGF 696 >gb|EYU32993.1| hypothetical protein MIMGU_mgv1a004259mg [Erythranthe guttata] Length = 482 Score = 65.9 bits (159), Expect = 7e-10 Identities = 30/40 (75%), Positives = 32/40 (80%) Frame = -1 Query: 458 HDFLEDEIKAWWCRTLDSGCKIPSLDELNSKLNDRKSLGF 339 HDFLEDEIKAWW R +G KIP LDELNSK DR+SLGF Sbjct: 443 HDFLEDEIKAWWSRLSKTGDKIPLLDELNSKFEDRESLGF 482 >ref|XP_012842681.1| PREDICTED: uncharacterized protein LOC105962888 isoform X2 [Erythranthe guttata] Length = 713 Score = 65.9 bits (159), Expect = 8e-10 Identities = 30/40 (75%), Positives = 32/40 (80%) Frame = -1 Query: 458 HDFLEDEIKAWWCRTLDSGCKIPSLDELNSKLNDRKSLGF 339 HDFLEDEIKAWW R +G KIP LDELNSK DR+SLGF Sbjct: 674 HDFLEDEIKAWWSRLSKTGDKIPLLDELNSKFEDRESLGF 713 >ref|XP_012842680.1| PREDICTED: uncharacterized protein LOC105962888 isoform X1 [Erythranthe guttata] Length = 727 Score = 65.9 bits (159), Expect = 8e-10 Identities = 30/40 (75%), Positives = 32/40 (80%) Frame = -1 Query: 458 HDFLEDEIKAWWCRTLDSGCKIPSLDELNSKLNDRKSLGF 339 HDFLEDEIKAWW R +G KIP LDELNSK DR+SLGF Sbjct: 688 HDFLEDEIKAWWSRLSKTGDKIPLLDELNSKFEDRESLGF 727 >ref|XP_011091141.1| PREDICTED: uncharacterized protein LOC105171651 isoform X3 [Sesamum indicum] Length = 858 Score = 64.7 bits (156), Expect = 2e-09 Identities = 29/40 (72%), Positives = 34/40 (85%) Frame = -1 Query: 458 HDFLEDEIKAWWCRTLDSGCKIPSLDELNSKLNDRKSLGF 339 HDFLEDEIKAWW R +++G ++PSL ELNSKL DRK LGF Sbjct: 819 HDFLEDEIKAWWIRIVNNGGQMPSLHELNSKLIDRKRLGF 858 >ref|XP_011091140.1| PREDICTED: uncharacterized protein LOC105171651 isoform X2 [Sesamum indicum] Length = 951 Score = 64.7 bits (156), Expect = 2e-09 Identities = 29/40 (72%), Positives = 34/40 (85%) Frame = -1 Query: 458 HDFLEDEIKAWWCRTLDSGCKIPSLDELNSKLNDRKSLGF 339 HDFLEDEIKAWW R +++G ++PSL ELNSKL DRK LGF Sbjct: 912 HDFLEDEIKAWWIRIVNNGGQMPSLHELNSKLIDRKRLGF 951 >ref|XP_011091136.1| PREDICTED: uncharacterized protein LOC105171651 isoform X1 [Sesamum indicum] gi|747087211|ref|XP_011091138.1| PREDICTED: uncharacterized protein LOC105171651 isoform X1 [Sesamum indicum] gi|747087213|ref|XP_011091139.1| PREDICTED: uncharacterized protein LOC105171651 isoform X1 [Sesamum indicum] Length = 955 Score = 64.7 bits (156), Expect = 2e-09 Identities = 29/40 (72%), Positives = 34/40 (85%) Frame = -1 Query: 458 HDFLEDEIKAWWCRTLDSGCKIPSLDELNSKLNDRKSLGF 339 HDFLEDEIKAWW R +++G ++PSL ELNSKL DRK LGF Sbjct: 916 HDFLEDEIKAWWIRIVNNGGQMPSLHELNSKLIDRKRLGF 955 >ref|XP_007034986.1| Zinc knuckle family protein, putative isoform 3 [Theobroma cacao] gi|508714015|gb|EOY05912.1| Zinc knuckle family protein, putative isoform 3 [Theobroma cacao] Length = 909 Score = 57.0 bits (136), Expect = 1e-06 Identities = 25/40 (62%), Positives = 30/40 (75%) Frame = -1 Query: 458 HDFLEDEIKAWWCRTLDSGCKIPSLDELNSKLNDRKSLGF 339 HDFLEDE+ AWW T SG KIPS +EL SK+ +R+ LGF Sbjct: 870 HDFLEDELMAWWSATTRSGGKIPSEEELTSKVKERRMLGF 909 >ref|XP_007034984.1| Zinc knuckle family protein, putative isoform 1 [Theobroma cacao] gi|590658913|ref|XP_007034985.1| Zinc knuckle family protein, putative isoform 1 [Theobroma cacao] gi|508714013|gb|EOY05910.1| Zinc knuckle family protein, putative isoform 1 [Theobroma cacao] gi|508714014|gb|EOY05911.1| Zinc knuckle family protein, putative isoform 1 [Theobroma cacao] Length = 1087 Score = 57.0 bits (136), Expect = 1e-06 Identities = 25/40 (62%), Positives = 30/40 (75%) Frame = -1 Query: 458 HDFLEDEIKAWWCRTLDSGCKIPSLDELNSKLNDRKSLGF 339 HDFLEDE+ AWW T SG KIPS +EL SK+ +R+ LGF Sbjct: 1048 HDFLEDELMAWWSATTRSGGKIPSEEELTSKVKERRMLGF 1087 >ref|XP_009794185.1| PREDICTED: uncharacterized protein LOC104240978 [Nicotiana sylvestris] Length = 962 Score = 56.2 bits (134), Expect = 2e-06 Identities = 22/39 (56%), Positives = 30/39 (76%) Frame = -1 Query: 455 DFLEDEIKAWWCRTLDSGCKIPSLDELNSKLNDRKSLGF 339 DFLEDE+ WWC+TL+SG K+P+ ++L KL +R LGF Sbjct: 924 DFLEDELTTWWCKTLESGGKVPAEEDLRLKLEERMKLGF 962 >emb|CDP19496.1| unnamed protein product [Coffea canephora] Length = 95 Score = 52.8 bits (125), Expect = 2e-06 Identities = 23/38 (60%), Positives = 28/38 (73%) Frame = -1 Query: 452 FLEDEIKAWWCRTLDSGCKIPSLDELNSKLNDRKSLGF 339 FLEDE+K WW RTL +G KIPS ++L +KL R LGF Sbjct: 58 FLEDELKVWWSRTLRNGGKIPSTEDLETKLRQRIKLGF 95 >emb|CDP21989.1| unnamed protein product [Coffea canephora] Length = 152 Score = 52.8 bits (125), Expect = 6e-06 Identities = 23/38 (60%), Positives = 28/38 (73%) Frame = -1 Query: 452 FLEDEIKAWWCRTLDSGCKIPSLDELNSKLNDRKSLGF 339 FLEDE+K WW RTL +G KIPS ++L +KL R LGF Sbjct: 115 FLEDELKVWWSRTLRNGGKIPSTEDLETKLRQRIKLGF 152 >ref|XP_010274164.1| PREDICTED: uncharacterized protein LOC104609531 isoform X3 [Nelumbo nucifera] Length = 992 Score = 54.3 bits (129), Expect = 8e-06 Identities = 22/40 (55%), Positives = 28/40 (70%) Frame = -1 Query: 458 HDFLEDEIKAWWCRTLDSGCKIPSLDELNSKLNDRKSLGF 339 HDFLEDE+ WW T SG K+P+++EL K +RK LGF Sbjct: 953 HDFLEDELMTWWSTTARSGRKLPTIEELKIKFEERKKLGF 992 >ref|XP_010274162.1| PREDICTED: uncharacterized protein LOC104609531 isoform X1 [Nelumbo nucifera] Length = 1175 Score = 54.3 bits (129), Expect = 8e-06 Identities = 22/40 (55%), Positives = 28/40 (70%) Frame = -1 Query: 458 HDFLEDEIKAWWCRTLDSGCKIPSLDELNSKLNDRKSLGF 339 HDFLEDE+ WW T SG K+P+++EL K +RK LGF Sbjct: 1136 HDFLEDELMTWWSTTARSGRKLPTIEELKIKFEERKKLGF 1175