BLASTX nr result
ID: Rehmannia27_contig00016105
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia27_contig00016105 (657 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_012827978.1| PREDICTED: uncharacterized protein LOC105949... 71 1e-11 ref|XP_012847871.1| PREDICTED: methyl-CpG-binding domain-contain... 67 3e-11 ref|XP_012847870.1| PREDICTED: methyl-CpG-binding domain-contain... 67 3e-11 >ref|XP_012827978.1| PREDICTED: uncharacterized protein LOC105949229 [Erythranthe guttata] gi|848928976|ref|XP_012827979.1| PREDICTED: uncharacterized protein LOC105949229 [Erythranthe guttata] Length = 203 Score = 70.9 bits (172), Expect = 1e-11 Identities = 34/72 (47%), Positives = 42/72 (58%), Gaps = 10/72 (13%) Frame = +1 Query: 472 SSEEPSKMEERTGDGSGETSS----------GPVKKPIKRRGSDDDSWMPEGWVKKVSQR 621 ++ +P K ER G+ S G KKP K+ DDDSWMPEGWVK+V++R Sbjct: 92 AANQPHKERERVGERSAMPCGPSKQKKAKLGGATKKPTKKTEEDDDSWMPEGWVKRVNKR 151 Query: 622 PQKGKFPGYVDK 657 P GKFPGY DK Sbjct: 152 PLTGKFPGYEDK 163 >ref|XP_012847871.1| PREDICTED: methyl-CpG-binding domain-containing protein 6-like isoform X2 [Erythranthe guttata] Length = 95 Score = 67.0 bits (162), Expect = 3e-11 Identities = 28/41 (68%), Positives = 32/41 (78%) Frame = +1 Query: 535 GPVKKPIKRRGSDDDSWMPEGWVKKVSQRPQKGKFPGYVDK 657 G KKP K+ DDDSWMPEGWVK+V++RP GKFPGY DK Sbjct: 15 GATKKPTKKTEVDDDSWMPEGWVKRVNKRPLTGKFPGYEDK 55 >ref|XP_012847870.1| PREDICTED: methyl-CpG-binding domain-containing protein 6-like isoform X1 [Erythranthe guttata] Length = 98 Score = 67.0 bits (162), Expect = 3e-11 Identities = 28/41 (68%), Positives = 32/41 (78%) Frame = +1 Query: 535 GPVKKPIKRRGSDDDSWMPEGWVKKVSQRPQKGKFPGYVDK 657 G KKP K+ DDDSWMPEGWVK+V++RP GKFPGY DK Sbjct: 15 GATKKPTKKTEVDDDSWMPEGWVKRVNKRPLTGKFPGYEDK 55