BLASTX nr result
ID: Rehmannia27_contig00015970
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia27_contig00015970 (455 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_012836880.1| PREDICTED: thioredoxin domain-containing pro... 158 2e-46 ref|XP_011088179.1| PREDICTED: thioredoxin domain-containing pro... 158 3e-46 emb|CDO97246.1| unnamed protein product [Coffea canephora] 156 2e-45 ref|XP_009599692.1| PREDICTED: thioredoxin domain-containing pro... 154 7e-45 ref|XP_009776292.1| PREDICTED: thioredoxin domain-containing pro... 154 1e-44 ref|XP_009767764.1| PREDICTED: thioredoxin domain-containing pro... 152 4e-44 ref|XP_008455854.1| PREDICTED: thioredoxin domain-containing pro... 152 6e-44 ref|XP_011650010.1| PREDICTED: thioredoxin domain-containing pro... 152 6e-44 ref|XP_015942041.1| PREDICTED: thioredoxin domain-containing pro... 152 8e-44 gb|EPS58044.1| hypothetical protein M569_16771 [Genlisea aurea] 152 8e-44 gb|KRG91067.1| hypothetical protein GLYMA_20G131000 [Glycine max] 150 9e-44 ref|XP_014512205.1| PREDICTED: thioredoxin domain-containing pro... 151 1e-43 ref|XP_010547969.1| PREDICTED: thioredoxin domain-containing pro... 150 2e-43 ref|XP_015056921.1| PREDICTED: thioredoxin domain-containing pro... 150 2e-43 ref|XP_004250298.1| PREDICTED: thioredoxin domain-containing pro... 150 2e-43 ref|XP_006352322.1| PREDICTED: thioredoxin domain-containing pro... 150 2e-43 dbj|BAT93924.1| hypothetical protein VIGAN_08047700 [Vigna angul... 150 3e-43 gb|KOM36239.1| hypothetical protein LR48_Vigan02g238900 [Vigna a... 150 3e-43 ref|XP_010065941.1| PREDICTED: thioredoxin domain-containing pro... 150 5e-43 gb|KHN06784.1| Thioredoxin domain-containing protein 9 like [Gly... 150 5e-43 >ref|XP_012836880.1| PREDICTED: thioredoxin domain-containing protein 9 homolog [Erythranthe guttata] gi|604333253|gb|EYU37604.1| hypothetical protein MIMGU_mgv1a013704mg [Erythranthe guttata] Length = 212 Score = 158 bits (400), Expect = 2e-46 Identities = 76/80 (95%), Positives = 79/80 (98%) Frame = -1 Query: 455 NEKEFFSVVKASERVVCHFYRENWPCKVMDKHLAILAKQHIETRFVKINAEKSPYLSEKL 276 NEKEFFSVVKAS+RVVCHFYRENWPCKV+DKHLAILAKQHIETRFVKINAEKSPYL EKL Sbjct: 74 NEKEFFSVVKASDRVVCHFYRENWPCKVVDKHLAILAKQHIETRFVKINAEKSPYLCEKL 133 Query: 275 RIVVLPTLALVKNAKVEDYV 216 RI+VLPTLALVKNAKVEDYV Sbjct: 134 RIIVLPTLALVKNAKVEDYV 153 >ref|XP_011088179.1| PREDICTED: thioredoxin domain-containing protein 9 homolog [Sesamum indicum] Length = 210 Score = 158 bits (399), Expect = 3e-46 Identities = 77/80 (96%), Positives = 79/80 (98%) Frame = -1 Query: 455 NEKEFFSVVKASERVVCHFYRENWPCKVMDKHLAILAKQHIETRFVKINAEKSPYLSEKL 276 NEK+FFS+VKASERVVCHFYRENWPCKVMDKHLAILAKQHIETRFVKINAEKS YLSEKL Sbjct: 74 NEKDFFSIVKASERVVCHFYRENWPCKVMDKHLAILAKQHIETRFVKINAEKSLYLSEKL 133 Query: 275 RIVVLPTLALVKNAKVEDYV 216 RIVVLPTLALVKNAKVEDYV Sbjct: 134 RIVVLPTLALVKNAKVEDYV 153 >emb|CDO97246.1| unnamed protein product [Coffea canephora] Length = 213 Score = 156 bits (394), Expect = 2e-45 Identities = 73/80 (91%), Positives = 80/80 (100%) Frame = -1 Query: 455 NEKEFFSVVKASERVVCHFYRENWPCKVMDKHLAILAKQHIETRFVKINAEKSPYLSEKL 276 NEKEFFS+VKASERVVCHFYR+NWPCKVMDKHL+ILAKQHIETRFVKI+AEKSPYL+EKL Sbjct: 74 NEKEFFSIVKASERVVCHFYRDNWPCKVMDKHLSILAKQHIETRFVKIHAEKSPYLAEKL 133 Query: 275 RIVVLPTLALVKNAKVEDYV 216 RIVVLPTLAL+KNAKV+DYV Sbjct: 134 RIVVLPTLALIKNAKVDDYV 153 >ref|XP_009599692.1| PREDICTED: thioredoxin domain-containing protein 9 homolog [Nicotiana tomentosiformis] Length = 210 Score = 154 bits (390), Expect = 7e-45 Identities = 74/79 (93%), Positives = 79/79 (100%) Frame = -1 Query: 452 EKEFFSVVKASERVVCHFYRENWPCKVMDKHLAILAKQHIETRFVKINAEKSPYLSEKLR 273 EKEFFSVVKAS+RVVCHFYR+NWPCKVMDKHL+ILAKQHIETRFVKI+AEKSPYL+EKLR Sbjct: 75 EKEFFSVVKASDRVVCHFYRDNWPCKVMDKHLSILAKQHIETRFVKIHAEKSPYLAEKLR 134 Query: 272 IVVLPTLALVKNAKVEDYV 216 IVVLPTLALVKNAKVEDYV Sbjct: 135 IVVLPTLALVKNAKVEDYV 153 >ref|XP_009776292.1| PREDICTED: thioredoxin domain-containing protein 9 homolog isoform X1 [Nicotiana sylvestris] gi|698576720|ref|XP_009776293.1| PREDICTED: thioredoxin domain-containing protein 9 homolog isoform X2 [Nicotiana sylvestris] Length = 210 Score = 154 bits (389), Expect = 1e-44 Identities = 73/79 (92%), Positives = 79/79 (100%) Frame = -1 Query: 452 EKEFFSVVKASERVVCHFYRENWPCKVMDKHLAILAKQHIETRFVKINAEKSPYLSEKLR 273 EKEFFSVVKAS+RVVCHFYR+NWPCKVMDKHL+ILAKQHIETRFVKI+AEKSPYL+EKLR Sbjct: 75 EKEFFSVVKASDRVVCHFYRDNWPCKVMDKHLSILAKQHIETRFVKIHAEKSPYLAEKLR 134 Query: 272 IVVLPTLALVKNAKVEDYV 216 +VVLPTLALVKNAKVEDYV Sbjct: 135 VVVLPTLALVKNAKVEDYV 153 >ref|XP_009767764.1| PREDICTED: thioredoxin domain-containing protein 9 homolog [Nicotiana sylvestris] Length = 210 Score = 152 bits (385), Expect = 4e-44 Identities = 73/79 (92%), Positives = 79/79 (100%) Frame = -1 Query: 452 EKEFFSVVKASERVVCHFYRENWPCKVMDKHLAILAKQHIETRFVKINAEKSPYLSEKLR 273 EKEFFSVVKAS+RVVCHFYR+NWPCKVMDKHL+ILAKQHIETRFVKI+AEKSPYL+EKLR Sbjct: 75 EKEFFSVVKASDRVVCHFYRDNWPCKVMDKHLSILAKQHIETRFVKIHAEKSPYLAEKLR 134 Query: 272 IVVLPTLALVKNAKVEDYV 216 IVVLPTLALVK+AKVEDYV Sbjct: 135 IVVLPTLALVKHAKVEDYV 153 >ref|XP_008455854.1| PREDICTED: thioredoxin domain-containing protein 9 homolog [Cucumis melo] gi|659111681|ref|XP_008455855.1| PREDICTED: thioredoxin domain-containing protein 9 homolog [Cucumis melo] Length = 213 Score = 152 bits (384), Expect = 6e-44 Identities = 71/79 (89%), Positives = 79/79 (100%) Frame = -1 Query: 452 EKEFFSVVKASERVVCHFYRENWPCKVMDKHLAILAKQHIETRFVKINAEKSPYLSEKLR 273 EK+FFSVVKAS+RVVCHFYRENWPCKVMDKHL+ILAKQHIETRFVKINAEKSP+L+EKL+ Sbjct: 75 EKDFFSVVKASDRVVCHFYRENWPCKVMDKHLSILAKQHIETRFVKINAEKSPFLAEKLK 134 Query: 272 IVVLPTLALVKNAKVEDYV 216 IVVLPTLAL+KNAKV+DYV Sbjct: 135 IVVLPTLALIKNAKVDDYV 153 >ref|XP_011650010.1| PREDICTED: thioredoxin domain-containing protein 9 homolog [Cucumis sativus] gi|700208142|gb|KGN63261.1| hypothetical protein Csa_2G418960 [Cucumis sativus] Length = 213 Score = 152 bits (384), Expect = 6e-44 Identities = 71/79 (89%), Positives = 79/79 (100%) Frame = -1 Query: 452 EKEFFSVVKASERVVCHFYRENWPCKVMDKHLAILAKQHIETRFVKINAEKSPYLSEKLR 273 EK+FFSVVKAS+RVVCHFYRENWPCKVMDKHL+ILAKQHIETRFVKINAEKSP+L+EKL+ Sbjct: 75 EKDFFSVVKASDRVVCHFYRENWPCKVMDKHLSILAKQHIETRFVKINAEKSPFLAEKLK 134 Query: 272 IVVLPTLALVKNAKVEDYV 216 IVVLPTLAL+KNAKV+DYV Sbjct: 135 IVVLPTLALIKNAKVDDYV 153 >ref|XP_015942041.1| PREDICTED: thioredoxin domain-containing protein 9 homolog [Arachis duranensis] Length = 210 Score = 152 bits (383), Expect = 8e-44 Identities = 70/80 (87%), Positives = 80/80 (100%) Frame = -1 Query: 455 NEKEFFSVVKASERVVCHFYRENWPCKVMDKHLAILAKQHIETRFVKINAEKSPYLSEKL 276 +EK+FFSVVKASERVVCHFYRENWPCKV+DKHL+ILAKQHIETRFVKINAEKSP+L+EKL Sbjct: 74 SEKDFFSVVKASERVVCHFYRENWPCKVVDKHLSILAKQHIETRFVKINAEKSPFLAEKL 133 Query: 275 RIVVLPTLALVKNAKVEDYV 216 +I+VLPTLAL+KNAKV+DYV Sbjct: 134 KIIVLPTLALIKNAKVDDYV 153 >gb|EPS58044.1| hypothetical protein M569_16771 [Genlisea aurea] Length = 211 Score = 152 bits (383), Expect = 8e-44 Identities = 72/80 (90%), Positives = 78/80 (97%) Frame = -1 Query: 455 NEKEFFSVVKASERVVCHFYRENWPCKVMDKHLAILAKQHIETRFVKINAEKSPYLSEKL 276 NEK+FFS+VKASERVVCHFYRENWPCKVMDKHLA+LAK H+ET+FVKINAEKS YLSEKL Sbjct: 74 NEKDFFSIVKASERVVCHFYRENWPCKVMDKHLAVLAKNHLETKFVKINAEKSLYLSEKL 133 Query: 275 RIVVLPTLALVKNAKVEDYV 216 RIVVLPTLALVK+AKVEDYV Sbjct: 134 RIVVLPTLALVKHAKVEDYV 153 >gb|KRG91067.1| hypothetical protein GLYMA_20G131000 [Glycine max] Length = 155 Score = 150 bits (378), Expect = 9e-44 Identities = 69/80 (86%), Positives = 79/80 (98%) Frame = -1 Query: 455 NEKEFFSVVKASERVVCHFYRENWPCKVMDKHLAILAKQHIETRFVKINAEKSPYLSEKL 276 +EK+FFSVVKASERVVCHF+RENWPCKVMDKHL ILAKQHIETRFVK+NAEKSP+L+EKL Sbjct: 74 SEKDFFSVVKASERVVCHFFRENWPCKVMDKHLNILAKQHIETRFVKLNAEKSPFLAEKL 133 Query: 275 RIVVLPTLALVKNAKVEDYV 216 +I+VLPTLAL+KNAKV+DYV Sbjct: 134 KIIVLPTLALIKNAKVDDYV 153 >ref|XP_014512205.1| PREDICTED: thioredoxin domain-containing protein 9 homolog [Vigna radiata var. radiata] Length = 213 Score = 151 bits (382), Expect = 1e-43 Identities = 70/80 (87%), Positives = 79/80 (98%) Frame = -1 Query: 455 NEKEFFSVVKASERVVCHFYRENWPCKVMDKHLAILAKQHIETRFVKINAEKSPYLSEKL 276 +EK+FFSVVKASERVVCHFYRENWPCKVMDKHL +LAKQHIETRFVKINAEKSP+L+EKL Sbjct: 74 SEKDFFSVVKASERVVCHFYRENWPCKVMDKHLNLLAKQHIETRFVKINAEKSPFLAEKL 133 Query: 275 RIVVLPTLALVKNAKVEDYV 216 +I+VLPTLAL+KNAKV+DYV Sbjct: 134 KIIVLPTLALIKNAKVDDYV 153 >ref|XP_010547969.1| PREDICTED: thioredoxin domain-containing protein 9 homolog [Tarenaya hassleriana] Length = 211 Score = 150 bits (380), Expect = 2e-43 Identities = 70/80 (87%), Positives = 79/80 (98%) Frame = -1 Query: 455 NEKEFFSVVKASERVVCHFYRENWPCKVMDKHLAILAKQHIETRFVKINAEKSPYLSEKL 276 +EK+FFSVVKASERVVCHFYRENWPCKVMDKH++ILAKQHIETRFVKI AEKSP+L+EKL Sbjct: 74 SEKDFFSVVKASERVVCHFYRENWPCKVMDKHMSILAKQHIETRFVKIQAEKSPFLAEKL 133 Query: 275 RIVVLPTLALVKNAKVEDYV 216 +IVVLPTLAL+KNAKV+DYV Sbjct: 134 KIVVLPTLALIKNAKVDDYV 153 >ref|XP_015056921.1| PREDICTED: thioredoxin domain-containing protein 9 homolog [Solanum pennellii] Length = 212 Score = 150 bits (380), Expect = 2e-43 Identities = 70/79 (88%), Positives = 79/79 (100%) Frame = -1 Query: 452 EKEFFSVVKASERVVCHFYRENWPCKVMDKHLAILAKQHIETRFVKINAEKSPYLSEKLR 273 EK+FFSVVKAS+RVVCHFYRENWPCKVMDKHL+ILAKQHIETRFVKINAEK+PYL+EKLR Sbjct: 74 EKDFFSVVKASDRVVCHFYRENWPCKVMDKHLSILAKQHIETRFVKINAEKAPYLAEKLR 133 Query: 272 IVVLPTLALVKNAKVEDYV 216 IVVLPTLAL+KNAKV++Y+ Sbjct: 134 IVVLPTLALIKNAKVDNYL 152 >ref|XP_004250298.1| PREDICTED: thioredoxin domain-containing protein 9 homolog [Solanum lycopersicum] Length = 212 Score = 150 bits (380), Expect = 2e-43 Identities = 70/79 (88%), Positives = 79/79 (100%) Frame = -1 Query: 452 EKEFFSVVKASERVVCHFYRENWPCKVMDKHLAILAKQHIETRFVKINAEKSPYLSEKLR 273 EK+FFSVVKAS+RVVCHFYRENWPCKVMDKHL+ILAKQHIETRFVKINAEK+PYL+EKLR Sbjct: 74 EKDFFSVVKASDRVVCHFYRENWPCKVMDKHLSILAKQHIETRFVKINAEKAPYLAEKLR 133 Query: 272 IVVLPTLALVKNAKVEDYV 216 IVVLPTLAL+KNAKV++Y+ Sbjct: 134 IVVLPTLALIKNAKVDNYL 152 >ref|XP_006352322.1| PREDICTED: thioredoxin domain-containing protein 9 homolog [Solanum tuberosum] Length = 214 Score = 150 bits (380), Expect = 2e-43 Identities = 70/79 (88%), Positives = 79/79 (100%) Frame = -1 Query: 452 EKEFFSVVKASERVVCHFYRENWPCKVMDKHLAILAKQHIETRFVKINAEKSPYLSEKLR 273 EK+FFSVVKAS+RVVCHFYRENWPCKVMDKHL+ILAKQHIETRFVKINAEK+PYL+EKLR Sbjct: 74 EKDFFSVVKASDRVVCHFYRENWPCKVMDKHLSILAKQHIETRFVKINAEKTPYLAEKLR 133 Query: 272 IVVLPTLALVKNAKVEDYV 216 IVVLPTLAL+KNAKV++Y+ Sbjct: 134 IVVLPTLALIKNAKVDNYL 152 >dbj|BAT93924.1| hypothetical protein VIGAN_08047700 [Vigna angularis var. angularis] Length = 213 Score = 150 bits (379), Expect = 3e-43 Identities = 69/80 (86%), Positives = 79/80 (98%) Frame = -1 Query: 455 NEKEFFSVVKASERVVCHFYRENWPCKVMDKHLAILAKQHIETRFVKINAEKSPYLSEKL 276 +EK+FFSVVKASERVVCHFYRENWPCKVMDKHL +LAKQHIETRF+KINAEKSP+L+EKL Sbjct: 74 SEKDFFSVVKASERVVCHFYRENWPCKVMDKHLNLLAKQHIETRFLKINAEKSPFLAEKL 133 Query: 275 RIVVLPTLALVKNAKVEDYV 216 +I+VLPTLAL+KNAKV+DYV Sbjct: 134 KIIVLPTLALIKNAKVDDYV 153 >gb|KOM36239.1| hypothetical protein LR48_Vigan02g238900 [Vigna angularis] Length = 213 Score = 150 bits (379), Expect = 3e-43 Identities = 69/80 (86%), Positives = 79/80 (98%) Frame = -1 Query: 455 NEKEFFSVVKASERVVCHFYRENWPCKVMDKHLAILAKQHIETRFVKINAEKSPYLSEKL 276 +EK+FFSVVKASERVVCHFYRENWPCKVMDKHL +LAKQHIETRF+KINAEKSP+L+EKL Sbjct: 74 SEKDFFSVVKASERVVCHFYRENWPCKVMDKHLNLLAKQHIETRFLKINAEKSPFLAEKL 133 Query: 275 RIVVLPTLALVKNAKVEDYV 216 +I+VLPTLAL+KNAKV+DYV Sbjct: 134 KIIVLPTLALIKNAKVDDYV 153 >ref|XP_010065941.1| PREDICTED: thioredoxin domain-containing protein 9 homolog [Eucalyptus grandis] gi|629097891|gb|KCW63656.1| hypothetical protein EUGRSUZ_G01295 [Eucalyptus grandis] Length = 212 Score = 150 bits (378), Expect = 5e-43 Identities = 69/79 (87%), Positives = 78/79 (98%) Frame = -1 Query: 452 EKEFFSVVKASERVVCHFYRENWPCKVMDKHLAILAKQHIETRFVKINAEKSPYLSEKLR 273 EK+FFS+VKAS+RVVCHFYRENWPCKVMDKH++ILAKQHIETRFVKI AEKSP+L+EKL+ Sbjct: 75 EKDFFSIVKASDRVVCHFYRENWPCKVMDKHMSILAKQHIETRFVKIQAEKSPFLAEKLK 134 Query: 272 IVVLPTLALVKNAKVEDYV 216 IVVLPTLAL+KNAKVEDYV Sbjct: 135 IVVLPTLALIKNAKVEDYV 153 >gb|KHN06784.1| Thioredoxin domain-containing protein 9 like [Glycine soja] Length = 213 Score = 150 bits (378), Expect = 5e-43 Identities = 70/80 (87%), Positives = 78/80 (97%) Frame = -1 Query: 455 NEKEFFSVVKASERVVCHFYRENWPCKVMDKHLAILAKQHIETRFVKINAEKSPYLSEKL 276 +EK+FF VVKASERVVCHFYRENWPCKVMDKHL ILAKQHIETRFVK+NAEKSP+L+EKL Sbjct: 74 SEKDFFPVVKASERVVCHFYRENWPCKVMDKHLNILAKQHIETRFVKLNAEKSPFLAEKL 133 Query: 275 RIVVLPTLALVKNAKVEDYV 216 +IVVLPTLAL+KNAKV+DYV Sbjct: 134 KIVVLPTLALIKNAKVDDYV 153