BLASTX nr result
ID: Rehmannia27_contig00015856
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia27_contig00015856 (866 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU35624.1| hypothetical protein MIMGU_mgv1a003002mg [Erythra... 62 3e-07 >gb|EYU35624.1| hypothetical protein MIMGU_mgv1a003002mg [Erythranthe guttata] Length = 616 Score = 62.0 bits (149), Expect = 3e-07 Identities = 45/111 (40%), Positives = 54/111 (48%), Gaps = 21/111 (18%) Frame = -3 Query: 726 MEIPL-GEETKKSDIADRQIHTEEEKRGENFSPEINGNGIAKSPDFER--------NDSE 574 M++P ET+K D EEEK GEN E NGNGI P R ND E Sbjct: 1 MDLPHEARETRKIDTGT----AEEEKGGENHCAEENGNGIVNPPGIGRSESERKIVNDYE 56 Query: 573 MIRPHSRLLKPETSSGMM-------EWFETPT-----AVGNFIRDKRNSFS 457 MIRPHS+L KP G++ E F +PT +G F R+K NS S Sbjct: 57 MIRPHSQLPKPAAPPGVIGRSQSLPEKFNSPTDSPAATIGKFFREKSNSVS 107