BLASTX nr result
ID: Rehmannia27_contig00013473
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia27_contig00013473 (720 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011071501.1| PREDICTED: U1 small nuclear ribonucleoprotei... 67 5e-10 >ref|XP_011071501.1| PREDICTED: U1 small nuclear ribonucleoprotein C-like [Sesamum indicum] gi|747050837|ref|XP_011071502.1| PREDICTED: U1 small nuclear ribonucleoprotein C-like [Sesamum indicum] Length = 198 Score = 66.6 bits (161), Expect = 5e-10 Identities = 31/43 (72%), Positives = 36/43 (83%), Gaps = 2/43 (4%) Frame = -2 Query: 719 PPPSSSGMQPAATQLYNVNPTGTTSATV--GGYSYPQASQTSH 597 PPPSSSG+ P ATQ++N NPTGTT+AT GGYSYPQ SQTS+ Sbjct: 156 PPPSSSGVLPPATQMFNANPTGTTAATATPGGYSYPQTSQTSN 198