BLASTX nr result
ID: Rehmannia27_contig00013134
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia27_contig00013134 (798 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_015874369.1| PREDICTED: interactor of constitutive active... 99 1e-21 ref|XP_007015497.1| ROP interactive partner 5 isoform 4 [Theobro... 100 2e-20 ref|XP_007015498.1| ROP interactive partner 5 isoform 5 [Theobro... 100 3e-20 ref|XP_007015495.1| ROP interactive partner 5 isoform 2 [Theobro... 100 3e-20 ref|XP_011089861.1| PREDICTED: LOW QUALITY PROTEIN: interactor o... 99 6e-20 ref|XP_015582753.1| PREDICTED: interactor of constitutive active... 94 3e-18 gb|EEF30117.1| ATP binding protein, putative [Ricinus communis] 94 3e-18 ref|XP_012485254.1| PREDICTED: interactor of constitutive active... 94 3e-18 ref|XP_011090049.1| PREDICTED: interactor of constitutive active... 93 4e-18 gb|EYU36214.1| hypothetical protein MIMGU_mgv1a0269351mg, partia... 93 6e-18 ref|XP_012838648.1| PREDICTED: LOW QUALITY PROTEIN: interactor o... 93 7e-18 gb|KHG05291.1| Interactor of constitutive active ROPs 3 -like pr... 93 7e-18 ref|XP_010043696.1| PREDICTED: interactor of constitutive active... 92 1e-17 ref|XP_010043695.1| PREDICTED: interactor of constitutive active... 92 1e-17 ref|XP_012064895.1| PREDICTED: interactor of constitutive active... 91 2e-17 ref|XP_012064892.1| PREDICTED: interactor of constitutive active... 91 2e-17 gb|KDO73129.1| hypothetical protein CISIN_1g006962mg [Citrus sin... 90 6e-17 ref|XP_009780113.1| PREDICTED: interactor of constitutive active... 90 8e-17 gb|KDO73127.1| hypothetical protein CISIN_1g006962mg [Citrus sin... 90 8e-17 ref|XP_006488183.1| PREDICTED: interactor of constitutive active... 90 8e-17 >ref|XP_015874369.1| PREDICTED: interactor of constitutive active ROPs 3-like [Ziziphus jujuba] Length = 201 Score = 98.6 bits (244), Expect = 1e-21 Identities = 45/62 (72%), Positives = 56/62 (90%) Frame = +1 Query: 22 MLSAGNNGQIMERTGSMDSHYGSPRTGKISSPYADDLDEDLMKKKNANMLRRFGVLWKKQ 201 MLSAGNNG++MERTGS+DS+Y P TGKISSPY++D+D+DL+KKKN NML++ GVLWKK Sbjct: 141 MLSAGNNGKVMERTGSLDSNY-DPVTGKISSPYSEDIDDDLLKKKNGNMLKKIGVLWKKP 199 Query: 202 QK 207 QK Sbjct: 200 QK 201 >ref|XP_007015497.1| ROP interactive partner 5 isoform 4 [Theobroma cacao] gi|508785860|gb|EOY33116.1| ROP interactive partner 5 isoform 4 [Theobroma cacao] Length = 509 Score = 99.8 bits (247), Expect = 2e-20 Identities = 45/62 (72%), Positives = 55/62 (88%) Frame = +1 Query: 22 MLSAGNNGQIMERTGSMDSHYGSPRTGKISSPYADDLDEDLMKKKNANMLRRFGVLWKKQ 201 MLSAGNNG+ MERTGS+DSHY +P TGK+SSPY +D+D+DL+KKKN NML++ GVLWKK Sbjct: 449 MLSAGNNGKFMERTGSLDSHY-NPVTGKVSSPYTEDMDDDLLKKKNGNMLKKIGVLWKKP 507 Query: 202 QK 207 QK Sbjct: 508 QK 509 >ref|XP_007015498.1| ROP interactive partner 5 isoform 5 [Theobroma cacao] gi|508785861|gb|EOY33117.1| ROP interactive partner 5 isoform 5 [Theobroma cacao] Length = 621 Score = 99.8 bits (247), Expect = 3e-20 Identities = 45/62 (72%), Positives = 55/62 (88%) Frame = +1 Query: 22 MLSAGNNGQIMERTGSMDSHYGSPRTGKISSPYADDLDEDLMKKKNANMLRRFGVLWKKQ 201 MLSAGNNG+ MERTGS+DSHY +P TGK+SSPY +D+D+DL+KKKN NML++ GVLWKK Sbjct: 561 MLSAGNNGKFMERTGSLDSHY-NPVTGKVSSPYTEDMDDDLLKKKNGNMLKKIGVLWKKP 619 Query: 202 QK 207 QK Sbjct: 620 QK 621 >ref|XP_007015495.1| ROP interactive partner 5 isoform 2 [Theobroma cacao] gi|590585675|ref|XP_007015496.1| ROP interactive partner 5 isoform 2 [Theobroma cacao] gi|508785858|gb|EOY33114.1| ROP interactive partner 5 isoform 2 [Theobroma cacao] gi|508785859|gb|EOY33115.1| ROP interactive partner 5 isoform 2 [Theobroma cacao] Length = 624 Score = 99.8 bits (247), Expect = 3e-20 Identities = 45/62 (72%), Positives = 55/62 (88%) Frame = +1 Query: 22 MLSAGNNGQIMERTGSMDSHYGSPRTGKISSPYADDLDEDLMKKKNANMLRRFGVLWKKQ 201 MLSAGNNG+ MERTGS+DSHY +P TGK+SSPY +D+D+DL+KKKN NML++ GVLWKK Sbjct: 564 MLSAGNNGKFMERTGSLDSHY-NPVTGKVSSPYTEDMDDDLLKKKNGNMLKKIGVLWKKP 622 Query: 202 QK 207 QK Sbjct: 623 QK 624 >ref|XP_011089861.1| PREDICTED: LOW QUALITY PROTEIN: interactor of constitutive active ROPs 3 [Sesamum indicum] Length = 628 Score = 99.0 bits (245), Expect = 6e-20 Identities = 49/52 (94%), Positives = 50/52 (96%) Frame = +1 Query: 52 MERTGSMDSHYGSPRTGKISSPYADDLDEDLMKKKNANMLRRFGVLWKKQQK 207 MERTGSMDS+Y SPRTGKISSPYADDLDEDLMKKKNANMLRRFGVLWKK QK Sbjct: 578 MERTGSMDSNY-SPRTGKISSPYADDLDEDLMKKKNANMLRRFGVLWKKPQK 628 >ref|XP_015582753.1| PREDICTED: interactor of constitutive active ROPs 3 [Ricinus communis] gi|1000941088|ref|XP_015582754.1| PREDICTED: interactor of constitutive active ROPs 3 [Ricinus communis] gi|1000941090|ref|XP_015582755.1| PREDICTED: interactor of constitutive active ROPs 3 [Ricinus communis] Length = 617 Score = 94.0 bits (232), Expect = 3e-18 Identities = 43/62 (69%), Positives = 53/62 (85%) Frame = +1 Query: 22 MLSAGNNGQIMERTGSMDSHYGSPRTGKISSPYADDLDEDLMKKKNANMLRRFGVLWKKQ 201 MLSAGNNG+ MERTGS+DS Y +P TG+I SPY +D+D+DL+KKKN NML++ GVLWKK Sbjct: 557 MLSAGNNGRFMERTGSLDSSY-NPATGRIGSPYNEDMDDDLLKKKNGNMLKKIGVLWKKP 615 Query: 202 QK 207 QK Sbjct: 616 QK 617 >gb|EEF30117.1| ATP binding protein, putative [Ricinus communis] Length = 618 Score = 94.0 bits (232), Expect = 3e-18 Identities = 43/62 (69%), Positives = 53/62 (85%) Frame = +1 Query: 22 MLSAGNNGQIMERTGSMDSHYGSPRTGKISSPYADDLDEDLMKKKNANMLRRFGVLWKKQ 201 MLSAGNNG+ MERTGS+DS Y +P TG+I SPY +D+D+DL+KKKN NML++ GVLWKK Sbjct: 558 MLSAGNNGRFMERTGSLDSSY-NPATGRIGSPYNEDMDDDLLKKKNGNMLKKIGVLWKKP 616 Query: 202 QK 207 QK Sbjct: 617 QK 618 >ref|XP_012485254.1| PREDICTED: interactor of constitutive active ROPs 3-like [Gossypium raimondii] gi|823172831|ref|XP_012485255.1| PREDICTED: interactor of constitutive active ROPs 3-like [Gossypium raimondii] gi|823172834|ref|XP_012485256.1| PREDICTED: interactor of constitutive active ROPs 3-like [Gossypium raimondii] gi|823172837|ref|XP_012485257.1| PREDICTED: interactor of constitutive active ROPs 3-like [Gossypium raimondii] gi|763768381|gb|KJB35596.1| hypothetical protein B456_006G121200 [Gossypium raimondii] gi|763768382|gb|KJB35597.1| hypothetical protein B456_006G121200 [Gossypium raimondii] gi|763768383|gb|KJB35598.1| hypothetical protein B456_006G121200 [Gossypium raimondii] Length = 624 Score = 94.0 bits (232), Expect = 3e-18 Identities = 44/62 (70%), Positives = 53/62 (85%) Frame = +1 Query: 22 MLSAGNNGQIMERTGSMDSHYGSPRTGKISSPYADDLDEDLMKKKNANMLRRFGVLWKKQ 201 MLSAGNNG+ MERTGS+DS+Y +P GK+S PYA+D DEDL+KKKN NML++ GVLWKK Sbjct: 564 MLSAGNNGKFMERTGSLDSNY-NPVKGKVSPPYAEDSDEDLLKKKNGNMLKKIGVLWKKP 622 Query: 202 QK 207 QK Sbjct: 623 QK 624 >ref|XP_011090049.1| PREDICTED: interactor of constitutive active ROPs 3-like [Sesamum indicum] Length = 412 Score = 92.8 bits (229), Expect = 4e-18 Identities = 45/62 (72%), Positives = 53/62 (85%) Frame = +1 Query: 22 MLSAGNNGQIMERTGSMDSHYGSPRTGKISSPYADDLDEDLMKKKNANMLRRFGVLWKKQ 201 ML AG+NGQ++ERTGSMD YG P T ++SS Y D+LD+DL+KKKNANML RFGVLWKKQ Sbjct: 352 MLLAGSNGQLVERTGSMDRIYG-PWTRRVSSAYVDELDDDLLKKKNANMLSRFGVLWKKQ 410 Query: 202 QK 207 QK Sbjct: 411 QK 412 >gb|EYU36214.1| hypothetical protein MIMGU_mgv1a0269351mg, partial [Erythranthe guttata] Length = 489 Score = 92.8 bits (229), Expect = 6e-18 Identities = 46/59 (77%), Positives = 51/59 (86%), Gaps = 2/59 (3%) Frame = +1 Query: 37 NNGQIMERTGSMDSHY-GSPRTGKISS-PYADDLDEDLMKKKNANMLRRFGVLWKKQQK 207 N GQIMER+GSMDSH+ GSPR GK+SS PY DD+D+DLMKKKNANMLRR GVLWKK K Sbjct: 431 NGGQIMERSGSMDSHFNGSPRMGKMSSSPYGDDVDDDLMKKKNANMLRRIGVLWKKPHK 489 >ref|XP_012838648.1| PREDICTED: LOW QUALITY PROTEIN: interactor of constitutive active ROPs 3 [Erythranthe guttata] Length = 618 Score = 92.8 bits (229), Expect = 7e-18 Identities = 46/59 (77%), Positives = 51/59 (86%), Gaps = 2/59 (3%) Frame = +1 Query: 37 NNGQIMERTGSMDSHY-GSPRTGKISS-PYADDLDEDLMKKKNANMLRRFGVLWKKQQK 207 N GQIMER+GSMDSH+ GSPR GK+SS PY DD+D+DLMKKKNANMLRR GVLWKK K Sbjct: 560 NGGQIMERSGSMDSHFNGSPRMGKMSSSPYGDDVDDDLMKKKNANMLRRIGVLWKKPHK 618 >gb|KHG05291.1| Interactor of constitutive active ROPs 3 -like protein [Gossypium arboreum] Length = 619 Score = 92.8 bits (229), Expect = 7e-18 Identities = 43/62 (69%), Positives = 53/62 (85%) Frame = +1 Query: 22 MLSAGNNGQIMERTGSMDSHYGSPRTGKISSPYADDLDEDLMKKKNANMLRRFGVLWKKQ 201 MLSAGNNG+ MERTGS+DS+Y +P GK+ SPYA+D DE+L+KKKN NML++ GVLWKK Sbjct: 559 MLSAGNNGKFMERTGSLDSNY-NPVKGKVGSPYAEDSDEELLKKKNGNMLKKIGVLWKKP 617 Query: 202 QK 207 QK Sbjct: 618 QK 619 >ref|XP_010043696.1| PREDICTED: interactor of constitutive active ROPs 3 isoform X2 [Eucalyptus grandis] gi|702272415|ref|XP_010043697.1| PREDICTED: interactor of constitutive active ROPs 3 isoform X2 [Eucalyptus grandis] gi|629121190|gb|KCW85680.1| hypothetical protein EUGRSUZ_B02460 [Eucalyptus grandis] gi|629121191|gb|KCW85681.1| hypothetical protein EUGRSUZ_B02460 [Eucalyptus grandis] Length = 622 Score = 92.4 bits (228), Expect = 1e-17 Identities = 41/62 (66%), Positives = 54/62 (87%) Frame = +1 Query: 22 MLSAGNNGQIMERTGSMDSHYGSPRTGKISSPYADDLDEDLMKKKNANMLRRFGVLWKKQ 201 MLS+GNNG+ M+RTGS+DS Y P TG++SSPYA+D+D+D++KKKN NML++ GVLWKK Sbjct: 562 MLSSGNNGKFMDRTGSLDSSY-DPVTGRMSSPYAEDMDDDMLKKKNGNMLKKIGVLWKKP 620 Query: 202 QK 207 QK Sbjct: 621 QK 622 >ref|XP_010043695.1| PREDICTED: interactor of constitutive active ROPs 3 isoform X1 [Eucalyptus grandis] gi|629121192|gb|KCW85682.1| hypothetical protein EUGRSUZ_B02460 [Eucalyptus grandis] Length = 625 Score = 92.4 bits (228), Expect = 1e-17 Identities = 41/62 (66%), Positives = 54/62 (87%) Frame = +1 Query: 22 MLSAGNNGQIMERTGSMDSHYGSPRTGKISSPYADDLDEDLMKKKNANMLRRFGVLWKKQ 201 MLS+GNNG+ M+RTGS+DS Y P TG++SSPYA+D+D+D++KKKN NML++ GVLWKK Sbjct: 565 MLSSGNNGKFMDRTGSLDSSY-DPVTGRMSSPYAEDMDDDMLKKKNGNMLKKIGVLWKKP 623 Query: 202 QK 207 QK Sbjct: 624 QK 625 >ref|XP_012064895.1| PREDICTED: interactor of constitutive active ROPs 3 isoform X2 [Jatropha curcas] Length = 618 Score = 91.3 bits (225), Expect = 2e-17 Identities = 42/62 (67%), Positives = 52/62 (83%) Frame = +1 Query: 22 MLSAGNNGQIMERTGSMDSHYGSPRTGKISSPYADDLDEDLMKKKNANMLRRFGVLWKKQ 201 MLSAGNNG++MERTGS+DS Y +P TG + SPY DD D+DLM+KKN NML++ GVLWK+ Sbjct: 558 MLSAGNNGKLMERTGSLDSSY-NPVTGSMDSPYNDDTDDDLMRKKNGNMLKKIGVLWKRP 616 Query: 202 QK 207 QK Sbjct: 617 QK 618 >ref|XP_012064892.1| PREDICTED: interactor of constitutive active ROPs 3 isoform X1 [Jatropha curcas] gi|802551614|ref|XP_012064893.1| PREDICTED: interactor of constitutive active ROPs 3 isoform X1 [Jatropha curcas] gi|802551616|ref|XP_012064894.1| PREDICTED: interactor of constitutive active ROPs 3 isoform X1 [Jatropha curcas] gi|643738133|gb|KDP44121.1| hypothetical protein JCGZ_05588 [Jatropha curcas] Length = 619 Score = 91.3 bits (225), Expect = 2e-17 Identities = 42/62 (67%), Positives = 52/62 (83%) Frame = +1 Query: 22 MLSAGNNGQIMERTGSMDSHYGSPRTGKISSPYADDLDEDLMKKKNANMLRRFGVLWKKQ 201 MLSAGNNG++MERTGS+DS Y +P TG + SPY DD D+DLM+KKN NML++ GVLWK+ Sbjct: 559 MLSAGNNGKLMERTGSLDSSY-NPVTGSMDSPYNDDTDDDLMRKKNGNMLKKIGVLWKRP 617 Query: 202 QK 207 QK Sbjct: 618 QK 619 >gb|KDO73129.1| hypothetical protein CISIN_1g006962mg [Citrus sinensis] Length = 438 Score = 89.7 bits (221), Expect = 6e-17 Identities = 41/62 (66%), Positives = 53/62 (85%) Frame = +1 Query: 22 MLSAGNNGQIMERTGSMDSHYGSPRTGKISSPYADDLDEDLMKKKNANMLRRFGVLWKKQ 201 MLS GNNG+ MER+GS+DS+Y +P TGKI PY+DD+D+DL+KKKN N+L++ GVLWKK Sbjct: 378 MLSTGNNGKCMERSGSIDSNY-NPITGKIPLPYSDDIDDDLLKKKNGNVLKKIGVLWKKP 436 Query: 202 QK 207 QK Sbjct: 437 QK 438 >ref|XP_009780113.1| PREDICTED: interactor of constitutive active ROPs 3-like isoform X4 [Nicotiana sylvestris] Length = 623 Score = 89.7 bits (221), Expect = 8e-17 Identities = 45/62 (72%), Positives = 51/62 (82%) Frame = +1 Query: 22 MLSAGNNGQIMERTGSMDSHYGSPRTGKISSPYADDLDEDLMKKKNANMLRRFGVLWKKQ 201 MLS GNNG+ MERTGSMDSHY SP GKISSPY +D+DEDLMK+KN N+L+R G LWKK Sbjct: 565 MLSNGNNGKFMERTGSMDSHY-SP--GKISSPYFEDMDEDLMKRKNPNVLKRIGELWKKP 621 Query: 202 QK 207 K Sbjct: 622 MK 623 >gb|KDO73127.1| hypothetical protein CISIN_1g006962mg [Citrus sinensis] gi|641854320|gb|KDO73128.1| hypothetical protein CISIN_1g006962mg [Citrus sinensis] Length = 623 Score = 89.7 bits (221), Expect = 8e-17 Identities = 41/62 (66%), Positives = 53/62 (85%) Frame = +1 Query: 22 MLSAGNNGQIMERTGSMDSHYGSPRTGKISSPYADDLDEDLMKKKNANMLRRFGVLWKKQ 201 MLS GNNG+ MER+GS+DS+Y +P TGKI PY+DD+D+DL+KKKN N+L++ GVLWKK Sbjct: 563 MLSTGNNGKCMERSGSIDSNY-NPITGKIPLPYSDDIDDDLLKKKNGNVLKKIGVLWKKP 621 Query: 202 QK 207 QK Sbjct: 622 QK 623 >ref|XP_006488183.1| PREDICTED: interactor of constitutive active ROPs 3 [Citrus sinensis] gi|568869964|ref|XP_006488184.1| PREDICTED: interactor of constitutive active ROPs 3 [Citrus sinensis] gi|568869966|ref|XP_006488185.1| PREDICTED: interactor of constitutive active ROPs 3 [Citrus sinensis] gi|985463489|ref|XP_015388909.1| PREDICTED: interactor of constitutive active ROPs 3 [Citrus sinensis] Length = 623 Score = 89.7 bits (221), Expect = 8e-17 Identities = 41/62 (66%), Positives = 53/62 (85%) Frame = +1 Query: 22 MLSAGNNGQIMERTGSMDSHYGSPRTGKISSPYADDLDEDLMKKKNANMLRRFGVLWKKQ 201 MLS GNNG+ MER+GS+DS+Y +P TGKI PY+DD+D+DL+KKKN N+L++ GVLWKK Sbjct: 563 MLSTGNNGKCMERSGSIDSNY-NPITGKIPLPYSDDIDDDLLKKKNGNVLKKIGVLWKKP 621 Query: 202 QK 207 QK Sbjct: 622 QK 623