BLASTX nr result
ID: Rehmannia27_contig00013037
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia27_contig00013037 (1467 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011083404.1| PREDICTED: phosphopantothenate--cysteine lig... 59 7e-06 >ref|XP_011083404.1| PREDICTED: phosphopantothenate--cysteine ligase 2-like [Sesamum indicum] gi|747072929|ref|XP_011083405.1| PREDICTED: phosphopantothenate--cysteine ligase 2-like [Sesamum indicum] Length = 326 Score = 58.5 bits (140), Expect = 7e-06 Identities = 30/39 (76%), Positives = 30/39 (76%) Frame = -2 Query: 119 MDASNGSRSFEETTYADIKSFFDSAPPLKDGAETKRKLE 3 MDA NGS SFEE YADIKSFFDSAP L D AETK K E Sbjct: 1 MDAINGSESFEEIPYADIKSFFDSAPSLGDAAETKIKEE 39