BLASTX nr result
ID: Rehmannia27_contig00012292
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia27_contig00012292 (402 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_012848522.1| PREDICTED: syntaxin-125 [Erythranthe guttata... 72 2e-12 gb|EYU44983.1| hypothetical protein MIMGU_mgv1a001920mg [Erythra... 58 3e-07 ref|XP_012847922.1| PREDICTED: eukaryotic translation initiation... 58 3e-07 gb|EPS68317.1| hypothetical protein M569_06460, partial [Genlise... 56 1e-06 >ref|XP_012848522.1| PREDICTED: syntaxin-125 [Erythranthe guttata] gi|604315203|gb|EYU27909.1| hypothetical protein MIMGU_mgv1a009836mg [Erythranthe guttata] Length = 330 Score = 72.0 bits (175), Expect = 2e-12 Identities = 34/54 (62%), Positives = 41/54 (75%) Frame = -3 Query: 367 SRERRQQQKPSTI*SNEVPESPLHHATQDHGRGPVLDTVAKIQERRDTMMEMFK 206 +RE+ + + +NEVPESPLHHA Q+HGRGPVLD VA+IQERRDTM E K Sbjct: 169 TREKATAEAIDNLIANEVPESPLHHAMQEHGRGPVLDAVAEIQERRDTMKETRK 222 >gb|EYU44983.1| hypothetical protein MIMGU_mgv1a001920mg [Erythranthe guttata] Length = 740 Score = 57.8 bits (138), Expect = 3e-07 Identities = 31/41 (75%), Positives = 33/41 (80%), Gaps = 1/41 (2%) Frame = -3 Query: 130 GIFRIKTKKKVKQSRSLSKRRSGEV-SFRKIESGGDGGEDN 11 G R+KTKKKVKQSRSLSKRRSGEV SFRKIE G G D+ Sbjct: 116 GQVRVKTKKKVKQSRSLSKRRSGEVMSFRKIEHGNSGDRDH 156 >ref|XP_012847922.1| PREDICTED: eukaryotic translation initiation factor 5B [Erythranthe guttata] Length = 784 Score = 57.8 bits (138), Expect = 3e-07 Identities = 31/41 (75%), Positives = 33/41 (80%), Gaps = 1/41 (2%) Frame = -3 Query: 130 GIFRIKTKKKVKQSRSLSKRRSGEV-SFRKIESGGDGGEDN 11 G R+KTKKKVKQSRSLSKRRSGEV SFRKIE G G D+ Sbjct: 116 GQVRVKTKKKVKQSRSLSKRRSGEVMSFRKIEHGNSGDRDH 156 >gb|EPS68317.1| hypothetical protein M569_06460, partial [Genlisea aurea] Length = 295 Score = 55.8 bits (133), Expect = 1e-06 Identities = 27/52 (51%), Positives = 36/52 (69%) Frame = -3 Query: 367 SRERRQQQKPSTI*SNEVPESPLHHATQDHGRGPVLDTVAKIQERRDTMMEM 212 S E+ I ++EV SPLH A ++ GRGPV++ VA+I+ERRDTMMEM Sbjct: 140 SGEKATADAIDRIIASEVAASPLHEALEEQGRGPVMEVVAEIEERRDTMMEM 191