BLASTX nr result
ID: Rehmannia27_contig00012276
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia27_contig00012276 (366 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011096879.1| PREDICTED: uncharacterized protein LOC105175... 69 2e-11 >ref|XP_011096879.1| PREDICTED: uncharacterized protein LOC105175929 [Sesamum indicum] Length = 648 Score = 68.9 bits (167), Expect = 2e-11 Identities = 33/42 (78%), Positives = 37/42 (88%) Frame = +2 Query: 2 SLPKVFQAVMLYSSAYAHSFEEILCNATVSECEDVQTPTYGI 127 SLPKVFQA+M+YSSAYAHSFE IL NAT+SE D+QT TYGI Sbjct: 607 SLPKVFQALMVYSSAYAHSFEVILSNATISEYRDMQTATYGI 648