BLASTX nr result
ID: Rehmannia27_contig00012088
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia27_contig00012088 (506 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AEI61928.1| DBP1-interacting protein 2 [Nicotiana tabacum] 53 7e-07 gb|KYP70876.1| hypothetical protein KK1_010115 [Cajanus cajan] 51 5e-06 ref|XP_009786070.1| PREDICTED: uncharacterized protein LOC104234... 51 6e-06 >gb|AEI61928.1| DBP1-interacting protein 2 [Nicotiana tabacum] Length = 52 Score = 53.1 bits (126), Expect = 7e-07 Identities = 25/37 (67%), Positives = 30/37 (81%) Frame = -2 Query: 409 MAKKIVRIEHRVEVAPRLVVFPVKPSHCPKLETIKED 299 MAKK+V ++ +EVAP LV+FP K SH PKLETIKED Sbjct: 1 MAKKVVNMKPCIEVAPPLVIFPTKLSHFPKLETIKED 37 >gb|KYP70876.1| hypothetical protein KK1_010115 [Cajanus cajan] Length = 49 Score = 50.8 bits (120), Expect = 5e-06 Identities = 24/45 (53%), Positives = 30/45 (66%) Frame = -2 Query: 409 MAKKIVRIEHRVEVAPRLVVFPVKPSHCPKLETIKEDIAEEEHGD 275 MAK I + +EVAP ++FP KPS+ P LETI ED+AEE D Sbjct: 1 MAKGIRNLSSWIEVAPAPIIFPTKPSNIPALETITEDVAEENDDD 45 >ref|XP_009786070.1| PREDICTED: uncharacterized protein LOC104234228 [Nicotiana sylvestris] Length = 58 Score = 50.8 bits (120), Expect = 6e-06 Identities = 28/48 (58%), Positives = 35/48 (72%), Gaps = 1/48 (2%) Frame = -2 Query: 409 MAKKIVRIEHRVEVAPRLVVFPVKPSHCPKLETIKE-DIAEEEHGDFK 269 MAKK+V ++ +EVAP LV+ P K SH PKLETIKE D AE ++ D K Sbjct: 7 MAKKVVNMKPWIEVAPPLVISPTKLSHSPKLETIKEDDRAEGQNEDDK 54