BLASTX nr result
ID: Rehmannia27_contig00012071
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia27_contig00012071 (499 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011083420.1| PREDICTED: hippocampus abundant transcript 1... 55 4e-06 >ref|XP_011083420.1| PREDICTED: hippocampus abundant transcript 1 protein-like [Sesamum indicum] Length = 444 Score = 55.5 bits (132), Expect = 4e-06 Identities = 25/36 (69%), Positives = 30/36 (83%) Frame = -1 Query: 223 GLCFEIFQLILMPILTQLMGEEKMLSVGLFFRCAHV 116 G+ + QLI+MPILT LMGEEKMLS+GLFF CAH+ Sbjct: 284 GIAGSVSQLIIMPILTPLMGEEKMLSLGLFFSCAHM 319